DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and SOBER1

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_193961.3 Gene:SOBER1 / 828325 AraportID:AT4G22300 Length:262 Species:Arabidopsis thaliana


Alignment Length:209 Identity:52/209 - (24%)
Similarity:95/209 - (45%) Gaps:6/209 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VIFFHGSGDTGPNVLEWVRFLIGRNLEYPHIKIIYPTAPKQKYTPLDGELSNVWFDRKSVNIAAS 82
            :::.||.||:|| ..|.::.|. |:.|:.:.|.::|:||....:...|.:...|||...:.:.|.
plant    51 ILWLHGLGDSGP-ANEPIKTLF-RSQEFRNTKWLFPSAPPNPVSCNYGAVMPSWFDIPELPLTAG 113

  Fly    83 ESK--KSMSQCYDAVNQLIDEEVASGIPLNRIVVGGFSMGGALALHTGYHLRRSLAGVFAHSSFL 145
            ..|  .|:.:....|:.:||:|:|.||....:.:.|||.||||.|.:.....:::.|....|.::
plant   114 SPKDESSLLKAVKNVHAIIDKEIAGGINPENVYICGFSQGGALTLASVLLYPKTIGGGAVFSGWI 178

  Fly   146 NRGSVVYDSLANGKDESFPELRMYHGERDTLVPKDWGLETFENLTKLGVKGTFHPLRNTLHELKT 210
            ...|.:.:...  :|.....:...||..|..|..:.|......|.:.||...|.......|.:..
plant   179 PFNSSITNQFT--EDAKKTPILWSHGIDDKTVLFEAGQAALPFLQQAGVTCEFKAYPGLGHSISN 241

  Fly   211 ASITDLQQWIYEKL 224
            ..:..|:.|:.:::
plant   242 EELQYLESWLKQRM 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 52/204 (25%)
SOBER1NP_193961.3 Abhydrolase 51..252 CDD:304388 52/204 (25%)
MhpC 51..>180 CDD:223669 38/130 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10655
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.