DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and AT3G15650

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001189903.1 Gene:AT3G15650 / 820808 AraportID:AT3G15650 Length:274 Species:Arabidopsis thaliana


Alignment Length:252 Identity:67/252 - (26%)
Similarity:107/252 - (42%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNATGKHTASVIFFHGSGDTGPNVLEW----------VRFL----IGRNLEYPHIKIIYPTAPKQ 58
            |...|||.|::::.||.||.|..:|..          |.|.    :..:|..|:||.|.||||.:
plant    26 VRPKGKHQATIVWLHGLGDNGSRILACSLITTSHFGSVSFCSSSQLLESLPLPNIKWICPTAPSR 90

  Fly    59 KYTPLDGELSNVWFDRKSVNIAASESKKSMSQCYDAVNQLIDEEVASGIPLN-RIVVGGFSMGGA 122
            ..:.|.|.....|||...::....:..:.:......:..|:..|     |.: ::.:||||||.|
plant    91 PVSLLGGFPCTAWFDVGEISEDLHDDIEGLDASAAHIANLLSAE-----PTDVKVGIGGFSMGAA 150

  Fly   123 LALH--TGYHLRRSLAGVFAHSSFLNRGSVV--------YDSLANGKDESFPE---------LRM 168
            :||:  |.|.|.|...|   |:..:|..:.|        :.|| ..|.||..|         :.:
plant   151 IALYSTTCYALGRYGTG---HAYTINLRATVGLSGWLPGWRSL-RSKIESSNEVARRAASIPILL 211

  Fly   169 YHGERDTLVPKDWGLETFENLTKLGVKGT-FHPLRNTLHELKTASITDLQQWIYEKL 224
            .||..|.:||..:|.::..:|...|.:.| |.|.....|......:.::..|:..:|
plant   212 AHGTSDDVVPYRFGEKSAHSLAMAGFRQTMFKPYEGLGHYTVPKEMDEVVHWLVSRL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 66/247 (27%)
AT3G15650NP_001189903.1 Abhydrolase 25..264 CDD:304388 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3034
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.