DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and CG18815

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001261719.1 Gene:CG18815 / 59176 FlyBaseID:FBgn0042138 Length:232 Species:Drosophila melanogaster


Alignment Length:220 Identity:76/220 - (34%)
Similarity:110/220 - (50%) Gaps:17/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNATGKHTASVIFFHGSGDTGPNVLEWVRFLIGRNLEYPHIKIIYPTAPKQKYTPLDGELSNVWF 72
            |.||.|.||::||.||.||||..   |...|..  :..|.:|:|.||||.|..:...|.....||
  Fly     7 VEATVKQTATLIFMHGLGDTGHG---WSSALAA--IRPPFMKVICPTAPTQPVSLNAGFRMPSWF 66

  Fly    73 DRKSVNIAASESKKSMSQCYDAVNQLIDEEVASGIPLNRIVVGGFSMGGALALHTGYHLRRSLAG 137
            |.|:::|...|.:..:....|:|:.:|.:|:::|||.||||:||||.||||||::.....:.|||
  Fly    67 DLKTLDIGGPEDEPGIQSARDSVHGMIQKEISAGIPANRIVLGGFSQGGALALYSALTYDQPLAG 131

  Fly   138 VFAHSSFLNRGSVVYDSLANGKDESFPELRMYHGERDTLVPKDWGLETFENLTKLGVKG-TFHPL 201
            |.|.|.:|........:..|..|   ..:...||:.|.:||..:| :...:|.|..:|. ||...
  Fly   132 VVALSCWLPLHKQFPGAKVNSDD---VPIFQAHGDYDPVVPYKFG-QLSASLLKSFMKNVTFKTY 192

  Fly   202 RNTLHELKTASITDLQ-------QW 219
            ....|......:.|::       ||
  Fly   193 SGLSHSSSDDEMDDVKDIISKWTQW 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 76/220 (35%)
CG18815NP_001261719.1 Abhydrolase_2 4..214 CDD:280406 74/215 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104939at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10655
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.