DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and lyplal1

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001011253.1 Gene:lyplal1 / 496699 XenbaseID:XB-GENE-953501 Length:235 Species:Xenopus tropicalis


Alignment Length:218 Identity:106/218 - (48%)
Similarity:140/218 - (64%) Gaps:1/218 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNATGKHTASVIFFHGSGDTGPNVLEWVRFLIGRNLEYPHIKIIYPTAPKQKYTPLDGELSNVWF 72
            |...|||:|||||.|||||:|..:..|:|.::.::|.:.|||:|:||||.:.|||::|.||:|||
 Frog    12 VAPAGKHSASVIFLHGSGDSGQGIKSWIREILKQDLAFKHIKVIFPTAPTRPYTPMNGALSSVWF 76

  Fly    73 DRKSVNIAASESKKSMSQCYDAVNQLIDEEVASGIPLNRIVVGGFSMGGALALHTGYHLRRSLAG 137
            ||..::|.:.|..:||......:..||:|||..||..|||::||||||||:|:|..|...:.:||
 Frog    77 DRYKISIQSPEHLESMDSMCQVLTSLINEEVNMGIMKNRILLGGFSMGGAMAMHLAYRYHKDVAG 141

  Fly   138 VFAHSSFLNRGSVVYDSLANGKDESFPELRMYHGERDTLVPKDWGLETFENLTKLGVKGTFHPLR 202
            |||.|||||.||::|.:|...| .|.|||...||..|.||...||.||...|..|||..:||...
 Frog   142 VFALSSFLNNGSILYKALKEAK-SSLPELFQCHGVADELVLHKWGEETNNLLKSLGVSSSFHSFP 205

  Fly   203 NTLHELKTASITDLQQWIYEKLP 225
            |..|||....:..|:.||.:|||
 Frog   206 NLYHELNLPELEQLRSWILQKLP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 102/212 (48%)
lyplal1NP_001011253.1 Abhydrolase 11..223 CDD:328752 101/211 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I3664
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3769
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 1 1.000 - - FOG0007342
OrthoInspector 1 1.000 - - oto105100
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5457
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.