DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and lypla2

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_989287.1 Gene:lypla2 / 394905 XenbaseID:XB-GENE-951391 Length:231 Species:Xenopus tropicalis


Alignment Length:233 Identity:74/233 - (31%)
Similarity:114/233 - (48%) Gaps:22/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PALT---TVNATGKHTASVIFFHGSGDTGPNVLEWVRFLIGRNLEYPHIKIIYPTAPKQKYTPLD 64
            |.||   ||.|..:.|.:|||.||.||||..   |...|..  :..||:|.|.|.||:...|...
 Frog     9 PLLTDAVTVPAGERETGAVIFLHGLGDTGHG---WAEALSA--IRLPHVKYICPHAPRIPVTLNM 68

  Fly    65 GELSNVWFDRKSVNIAASESKKSMSQCYDAVNQLIDEEVASGIPLNRIVVGGFSMGGALALHTGY 129
            ..:...|||...::..|.|.:..:.:..:::..:|:.||.:|||.||||:||||.||||:|:|..
 Frog    69 KMVMPAWFDLMGLSPDAPEDEAGIKKAAESIKTIIEHEVKNGIPANRIVLGGFSQGGALSLYTAL 133

  Fly   130 HLRRSLAGVFAHSSFLNRGSVVYDSLANGKDESFPELRMYHGERDTLVPKDWGLETFENLTKLGV 194
            ..:..||||...|.:|.... .:...|:|.::....|:. |||.|.::|..:|     |||...:
 Frog   134 SCQHKLAGVIGLSCWLPLHK-TFPQAASGVNKEISVLQC-HGEADPMIPVRFG-----NLTSEKL 191

  Fly   195 KGTFHPLR-------NTLHELKTASITDLQQWIYEKLP 225
            |...:|.:       ..:|......:..::.::.:.||
 Frog   192 KSVLNPSKVQFKSYPGVMHSTNQEEMMAVKDFLEKVLP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 69/220 (31%)
lypla2NP_989287.1 Abhydrolase_2 11..228 CDD:334855 71/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.