DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and Lypla1

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_038965233.1 Gene:Lypla1 / 25514 RGDID:3025 Length:235 Species:Rattus norvegicus


Alignment Length:202 Identity:75/202 - (37%)
Similarity:100/202 - (49%) Gaps:11/202 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PALTTVNATGKHTASVIFFHGSGDTGPNVLEWVRFLIGRNLEYPHIKIIYPTAPKQKYTPLDGEL 67
            |....|.|..|.||:|||.||.||||..   |.....|  ::..|||.|.|.||....|.....:
  Rat     9 PMPAVVPAARKATAAVIFLHGLGDTGHG---WAEAFAG--IKSSHIKYICPHAPVMPVTLNMSMM 68

  Fly    68 SNVWFDRKSVNIAASESKKSMSQCYDAVNQLIDEEVASGIPLNRIVVGGFSMGGALALHTGYHLR 132
            ...|||...::..:.|.:..:.|..:.|..|||:||.:|||.|||::||||.||||:|:|....:
  Rat    69 MPSWFDIIGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQ 133

  Fly   133 RSLAGVFAHSSFLNRGSVVYDSLANGKDESFPELRMYHGERDTLVPKDWGLETFENLTKLGVKGT 197
            :.||||.|.|.:|...:.......|..:.....|:. ||:.|.|||..:|..|.|.|     ||.
  Rat   134 QKLAGVTALSCWLPLRASFSQGPINSANRDISVLQC-HGDCDPLVPLMFGSLTVERL-----KGL 192

  Fly   198 FHPLRNT 204
            .:|...|
  Rat   193 VNPANVT 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 74/198 (37%)
Lypla1XP_038965233.1 Abhydrolase_2 8..229 CDD:396693 75/202 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.