DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and SPAC8E11.04c

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_594165.1 Gene:SPAC8E11.04c / 2542889 PomBaseID:SPAC8E11.04c Length:224 Species:Schizosaccharomyces pombe


Alignment Length:206 Identity:68/206 - (33%)
Similarity:99/206 - (48%) Gaps:7/206 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNATGKHTASVIFFHGSGDTGPNVLEWVRFLIGRNLEYPHIKIIYPTAPKQKYTPLDGELSNVWF 72
            :|.:..|||:|||.||.||:|..   | .|:......:.|||.|:|.||....|..:|.....|:
pombe    10 INPSVAHTATVIFLHGLGDSGQG---W-SFMANTWSNFKHIKWIFPNAPSIPVTVNNGMKMPAWY 70

  Fly    73 DRKSVNIAASESKKSMSQCYDAVNQLIDEEVASGIPLNRIVVGGFSMGGALALHTGYHLRRSLAG 137
            |..|......|.:..:.:....:::|||.|:|.|||.:||::||||.|..::|:.|....:.|||
pombe    71 DIYSFADMKREDENGILRSAGQLHELIDAELALGIPSDRILIGGFSQGCMVSLYAGLTYPKRLAG 135

  Fly   138 VFAHSSFLNRGSVVYDSLANGKDESFPELRMYHGERDTLVPKDWGLETFENL-TKLGVKGTFHPL 201
            :..||.||...|....:|:....| .|.|..|..| |.:||......:.:.| ..|.:|....|.
pombe   136 IMGHSGFLPLASKFPSALSRVAKE-IPILLTYMTE-DPIVPSVLSSASAKYLINNLQLKCLDRPF 198

  Fly   202 RNTLHELKTAS 212
            ....|.|.:.|
pombe   199 EGDAHSLSSES 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 68/206 (33%)
SPAC8E11.04cNP_594165.1 Abhydrolase_2 7..221 CDD:280406 68/206 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10655
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.