DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and SPAC9G1.08c

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_593563.1 Gene:SPAC9G1.08c / 2542787 PomBaseID:SPAC9G1.08c Length:241 Species:Schizosaccharomyces pombe


Alignment Length:140 Identity:37/140 - (26%)
Similarity:61/140 - (43%) Gaps:25/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VIFFHGSGDTGPNVLEWVRFLIGRNLEYPHIKIIYPTAPKQKYTPLD----------GELSNVWF 72
            ||..||.||:..:...     :.:|:..|:...|....|.:  .|||          ||  :|.|
pombe    27 VILMHGLGDSHKSFAN-----MAKNVPLPNTSYISLRGPYR--LPLDFENPGGNWMWGE--DVHF 82

  Fly    73 DRKSVNIAASESKKSMSQCYDAVNQLIDEEVASGIPLNRIVVGGFSMGGALALHTGYHL--RRSL 135
            |:.    ...:|:...|:.:..::.||...::.||..:||...||..|..:||::.|.|  :..|
pombe    83 DQN----GELQSEADFSKSFTMISNLIGNLLSYGILSSRIFFFGFGQGAMVALYSCYKLSTKYQL 143

  Fly   136 AGVFAHSSFL 145
            .|:|:....|
pombe   144 GGIFSFGGTL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 37/140 (26%)
SPAC9G1.08cNP_593563.1 Abhydrolase_2 14..229 CDD:280406 37/140 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10655
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.