DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and F01D5.8

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_496938.2 Gene:F01D5.8 / 175052 WormBaseID:WBGene00008498 Length:362 Species:Caenorhabditis elegans


Alignment Length:154 Identity:39/154 - (25%)
Similarity:61/154 - (39%) Gaps:37/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 EEVASGIPLNRIVVGGFSMGGALALHTGYHLRRSLAGVFAHSSFLNRGSVVYDSLANGKD----- 160
            |::....|..:|||.|:|:|...|:.........||||...:.|.: |..::.|..:..|     
 Worm   198 EKILEMRPDKKIVVMGYSIGTTAAVDLAATNPDRLAGVVLIAPFTS-GLRLFSSKPDKPDTCWAD 261

  Fly   161 --ESFPELR-------MYHGERDTLVPKDWGLETFENLTK----LGVKGTFHP------------ 200
              :||.::.       :.||:.|.::|...||..:|.|..    |.|.|..|.            
 Worm   262 SFKSFDKINNIDTRVLICHGDVDEVIPLSHGLALYEKLKNPVPPLIVHGANHHTILSGKYIHVFT 326

  Fly   201 -----LRN-TLHELKTASITDLQQ 218
                 ||| ||...::|.:...||
 Worm   327 RIANFLRNETLVSCRSAEVDSSQQ 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 39/154 (25%)
F01D5.8NP_496938.2 MhpC 162..334 CDD:223669 32/136 (24%)
Abhydrolase_1 168..>243 CDD:366166 14/44 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.