DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6567 and AT4G22305

DIOPT Version :9

Sequence 1:NP_001097742.1 Gene:CG6567 / 41304 FlyBaseID:FBgn0037842 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001190797.1 Gene:AT4G22305 / 10723040 AraportID:AT4G22305 Length:228 Species:Arabidopsis thaliana


Alignment Length:218 Identity:52/218 - (23%)
Similarity:92/218 - (42%) Gaps:24/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VIFFHGSGDTGP-NVLEWVRFLIGRNLEYPHIKIIYPTAPKQKYTPLDGELSNVWFDRKSV--NI 79
            :::.||.||:|| |.....:|   ::.|..:...::|:||....|..:|.:...|||...:  .:
plant     6 ILWLHGLGDSGPANEPIQTQF---KSSELSNASWLFPSAPFNPVTCNNGAVMRSWFDVPELPFKV 67

  Fly    80 AASESKKSMSQCYDAVNQLIDEEVASGIPLNRIVVGGFSMGGALALHTGYHLRRSLAGVFAHSSF 144
            .:...:.|:.:....|:.:||:|:|.|.....:.:.|.|.||||          :||.|..:...
plant    68 GSPIDESSVLEAVKNVHAIIDQEIAEGTNPENVFICGLSQGGAL----------TLASVLLYPKT 122

  Fly   145 LNRGSVV--YDSLANGKDESFPE------LRMYHGERDTLVPKDWGLETFENLTKLGVKGTFHPL 201
            |..|:|:  :....:.....|||      :...||..|.:|..:.|......|.:.||...|...
plant   123 LGGGAVLSGWVPFTSSIISQFPEEAKKTPILWSHGTDDRMVLFEAGQAALPFLKEAGVTCEFKAY 187

  Fly   202 RNTLHELKTASITDLQQWIYEKL 224
            ....|.:....:..::.||..:|
plant   188 PGLGHSISNKELKYIESWIKRRL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6567NP_001097742.1 Abhydrolase 7..221 CDD:304388 50/213 (23%)
AT4G22305NP_001190797.1 Abhydrolase 6..207 CDD:419691 50/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373549at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10655
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.