DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4565 and SETDB1

DIOPT Version :10

Sequence 1:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001353346.1 Gene:SETDB1 / 9869 HGNCID:10761 Length:1292 Species:Homo sapiens


Alignment Length:166 Identity:51/166 - (30%)
Similarity:68/166 - (40%) Gaps:40/166 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDESETAPNDDYEHPDGLDYILESVLMPSDG-----SKEFKFLADEYNSVLLNPCHCKGACENSE 60
            ::|.:|.|      |..:.|..|.:  |..|     ..||           |..|.||..|.:..
Human   695 VNEIDTTP------PPQVAYSKERI--PGKGVFINTGPEF-----------LVGCDCKDGCRDKS 740

  Fly    61 VCA-H-----------GGQYEFTEDGSELILRNSANP--VIECNDMCKCCRNTCSNRLVYSGPRK 111
            .|| |           |||.. ...|.:........|  |.|||..|||..|.|:||||..|.:.
Human   741 KCACHQLTIQATACTPGGQIN-PNSGYQYKRLEECLPTGVYECNKRCKCDPNMCTNRLVQHGLQV 804

  Fly   112 HLEIFDSPVYGSKGLRTTAKITKGGYICEYAGELLT 147
            .|::|.:...| .|:|....|.||.::|.|||::||
Human   805 RLQLFKTQNKG-WGIRCLDDIAKGSFVCIYAGKILT 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4565NP_001097743.1 SET_SETMAR 16..267 CDD:380942 47/151 (31%)
SETDB1NP_001353346.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..147
DUF5604 193..250 CDD:408109
Tudor_SETDB1_rpt1 260..341 CDD:410453
Tudor_SETDB1_rpt2 348..401 CDD:410548
MBD 598..673 CDD:128673
SET_SETDB1 675..>876 CDD:380915 51/166 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 869..1161
SET <1203..1292 CDD:394802
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.