DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4565 and SETD1A

DIOPT Version :10

Sequence 1:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_055527.1 Gene:SETD1A / 9739 HGNCID:29010 Length:1707 Species:Homo sapiens


Alignment Length:252 Identity:62/252 - (24%)
Similarity:100/252 - (39%) Gaps:48/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PSDGSKEF--------------KFLADEYNSVLLNPCHCKGACENSE-VCAHGGQYEFTEDGSE- 76
            |.||.:|.              |...|:|..|      |..:....| |...|.....:|..|| 
Human  1482 PQDGPREHQTGSARSEGYYPISKKEKDKYLDV------CPVSARQLEGVDTQGTNRVLSERRSEQ 1540

  Fly    77 -LILRNSANPVIECNDMCKCCRNTCSNRLVYSGPRKHLEIFDSPVYGSKGLRTTAKITKGGYICE 140
             .:|.......|..:|:.|.      |:|.:.  :|.|....|.:: ..||.....|.....:.|
Human  1541 RRLLSAIGTSAIMDSDLLKL------NQLKFR--KKKLRFGRSRIH-EWGLFAMEPIAADEMVIE 1596

  Fly   141 YAGELL--TVPEARSRLHDNEKLGLMNYILVLNEYTSDKKQQVTIVDPSRRGNIGRYLNHSCEPN 203
            |.|:.:  .|.:.|.:.:..|.:| .:|:.        :....||:|.::.||:.|::||.|.||
Human  1597 YVGQNIRQMVADMREKRYVQEGIG-SSYLF--------RVDHDTIIDATKCGNLARFINHCCTPN 1652

  Fly   204 CHIAAVRIDCPIPKIGIFAARDIAAKEELCFHYGGEGQYKKMTGGKTCLCGASKCTG 260
            |:...:.|:.. .||.|::.:.|...||:.:.|....:..|:    .||||...|.|
Human  1653 CYAKVITIESQ-KKIVIYSKQPIGVDEEITYDYKFPLEDNKI----PCLCGTESCRG 1704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4565NP_001097743.1 SET_SETMAR 16..267 CDD:380942 62/252 (25%)
SETD1ANP_055527.1 Interaction with WDR82. /evidence=ECO:0000269|PubMed:37030068 60..89
RRM_Set1A 92..186 CDD:409964
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..308
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..363
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..486
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 506..655
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 834..854
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 891..1251
PRK12323 <1070..>1130 CDD:481241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1264..1293
HCFC1-binding motif (HBM) 1299..1303
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1307..1417
Interaction with CFP1 1415..1450
N-SET 1425..1562 CDD:463344 19/91 (21%)
Interaction with ASH2L, RBBP5 and WDR5. /evidence=ECO:0000269|PubMed:17998332 1450..1537 13/60 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1472..1499 4/16 (25%)
WDR5 interaction motif (WIN). /evidence=ECO:0000269|PubMed:22266653, ECO:0000269|PubMed:22665483 1492..1497 0/4 (0%)
RxxxRR motif. /evidence=ECO:0000250|UniProtKB:P38827 1537..1542 2/4 (50%)
SET_SETD1 1556..1703 CDD:380946 43/169 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.