DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4565 and EFS

DIOPT Version :10

Sequence 1:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_177854.6 Gene:EFS / 844066 AraportID:AT1G77300 Length:1805 Species:Arabidopsis thaliana


Alignment Length:218 Identity:64/218 - (29%)
Similarity:96/218 - (44%) Gaps:35/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CHCKGACENSEVCAHGGQYEFTEDGSELILRNSANPVIECNDMCKCCRNTCSNRLVYSGPRKHLE 114
            ||||.:.:....|            .|..|....|  |||........:.|||:..........|
plant   979 CHCKPSPDGRLGC------------GEECLNRMLN--IECLQGTCPAGDLCSNQQFQKRKYVKFE 1029

  Fly   115 IFDSPVYGSK--GLRTTAKITKGGYICEYAGELLTVPEARSRLHDNEKLGLMN-YILVLNEYTSD 176
            .|.|   |.|  |||....:.:|.::.||.||:|.:....:|..:....|..: |.:.||..   
plant  1030 RFQS---GKKGYGLRLLEDVREGQFLIEYVGEVLDMQSYETRQKEYAFKGQKHFYFMTLNGN--- 1088

  Fly   177 KKQQVTIVDPSRRGNIGRYLNHSCEPNCHIAAVRIDCPIPKIGIFAARDIAAKEELCFHYGGEGQ 241
                 .::|...:||:||::||||||||......::..| .:|||:.:|:...:||.|.|    .
plant  1089 -----EVIDAGAKGNLGRFINHSCEPNCRTEKWMVNGEI-CVGIFSMQDLKKGQELTFDY----N 1143

  Fly   242 YKKMTG--GKTCLCGASKCTGFM 262
            |.::.|  .|.|.||:|.|.|::
plant  1144 YVRVFGAAAKKCYCGSSHCRGYI 1166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4565NP_001097743.1 SET_SETMAR 16..267 CDD:380942 64/218 (29%)
EFSNP_177854.6 zf-CW 865..910 CDD:462181
AWS 975..1025 CDD:197795 14/59 (24%)
SET_SETD2 1025..1167 CDD:380949 50/158 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.