DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4565 and SDG14

DIOPT Version :10

Sequence 1:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_191733.3 Gene:SDG14 / 825347 AraportID:AT3G61740 Length:1018 Species:Arabidopsis thaliana


Alignment Length:164 Identity:49/164 - (29%)
Similarity:72/164 - (43%) Gaps:25/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KHLEIFD--------SPVYGSKGLRTTAKITKGGYICEYAGELLTVPEARSRLHDNEKLGLMNYI 167
            |||:..:        |.::| .||.....|.:|..|.||.|..:....|..|..:....|...|:
plant   867 KHLQRTENFRVCFGKSGIHG-WGLFARKSIQEGEMIIEYRGVKVRRSVADLREANYRSQGKDCYL 930

  Fly   168 LVLNEYTSDKKQQVTIVDPSRRGNIGRYLNHSCEPNCHIAAVRI-DCPIPKIGIFAARDIAAKEE 231
            ..::|        ..::|.:..|||.|.:||||.|||:...|.: |....:|.:.|..::||.||
plant   931 FKISE--------EIVIDATDSGNIARLINHSCMPNCYARIVSMGDGEDNRIVLIAKTNVAAGEE 987

  Fly   232 LCFHY---GGEGQYKKMTGGKTCLCGASKCTGFM 262
            |.:.|   ..|.:..|:    .|||.|..|..||
plant   988 LTYDYLFEVDESEEIKV----PCLCKAPNCRKFM 1017

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4565NP_001097743.1 SET_SETMAR 16..267 CDD:380942 49/164 (30%)
SDG14NP_191733.3 PWWP_AtATX3-like 188..292 CDD:438971
PHD_TCF19_like 365..415 CDD:276992
COG5141 <518..>765 CDD:227470
ePHD_ATX3_4_5_like 603..714 CDD:277133
SET_SETD1-like 862..1014 CDD:380916 46/159 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.