DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4565 and ezh1

DIOPT Version :10

Sequence 1:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001035072.2 Gene:ezh1 / 664754 ZFINID:ZDB-GENE-050114-1 Length:756 Species:Danio rerio


Alignment Length:199 Identity:63/199 - (31%)
Similarity:92/199 - (46%) Gaps:44/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CHCKGACENSEVCAHGGQYEFTEDGSELILRNSANPVIECN-DMCKCC---------RNTCSNRL 104
            |.||..| |::.|.           ..|.:|       ||: |:|..|         :.:|.|..
Zfish   570 CRCKTQC-NTKQCP-----------CYLAVR-------ECDPDLCMTCGAADHWDSKQVSCKNCS 615

  Fly   105 VYSGPRKHLEIFDSPVYGSKGLRTTAKITKGGYICEYAGELLTVPEA--RSRLHDNEKLGLMNYI 167
            :..|.:|||.:..|.|.| .|......:.|..:|.||.|||::..||  |.|::|..   :.:::
Zfish   616 IQRGLKKHLLLAPSDVAG-WGTFIKEPVQKNEFISEYCGELISQDEADRRGRIYDKY---MSSFL 676

  Fly   168 LVLNEYTSDKKQQVTIVDPSRRGNIGRYLNHSCEPNCHIAAVRIDCPIPKIGIFAARDIAAKEEL 232
            ..||   :|     .:||.:|:||..|:.|||..|||:...|.::.. .:|||||.|.|...|||
Zfish   677 FNLN---ND-----FVVDATRKGNKIRFANHSVNPNCYAKVVMVNGD-HRIGIFAKRAIQQGEEL 732

  Fly   233 CFHY 236
            .|.|
Zfish   733 FFDY 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4565NP_001097743.1 SET_SETMAR 16..267 CDD:380942 63/199 (32%)
ezh1NP_001035072.2 EZH2_WD-Binding 45..74 CDD:463308
PRC2_HTH_1 164..286 CDD:436286
SANT 447..489 CDD:238096
preSET_CXC 569..600 CDD:408079 13/48 (27%)
SET_EZH1 617..752 CDD:380994 48/133 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.