DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4565 and E(z)

DIOPT Version :10

Sequence 1:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001261682.1 Gene:E(z) / 39203 FlyBaseID:FBgn0000629 Length:765 Species:Drosophila melanogaster


Alignment Length:210 Identity:66/210 - (31%)
Similarity:96/210 - (45%) Gaps:44/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CHCKGACENSEVCAHGGQYEFTEDGSELILRNSANPVIECN-DMCKCC--------RNTCSNRLV 105
            |.||..| |::.|.           ..|.:|       ||: |:|:.|        :.||.|..|
  Fly   580 CRCKAQC-NTKQCP-----------CYLAVR-------ECDPDLCQACGADQFKLTKITCKNVCV 625

  Fly   106 YSGPRKHLEIFDSPVYGSKGLRTTAKITKGGYICEYAGELLTVPEA--RSRLHDNEKLGLMNYIL 168
            ..|..|||.:..|.:.| .|:.......|..:|.||.||:::..||  |.:::|..   :.:::.
  Fly   626 QRGLHKHLLMAPSDIAG-WGIFLKEGAQKNEFISEYCGEIISQDEADRRGKVYDKY---MCSFLF 686

  Fly   169 VLNEYTSDKKQQVTIVDPSRRGNIGRYLNHSCEPNCHIAAVRIDCPIPKIGIFAARDIAAKEELC 233
            .||   :|     .:||.:|:||..|:.|||..|||: |.|.:.....:|||||.|.|...|||.
  Fly   687 NLN---ND-----FVVDATRKGNKIRFANHSINPNCY-AKVMMVTGDHRIGIFAKRAIQPGEELF 742

  Fly   234 FHYG-GEGQYKKMTG 247
            |.|. |..:..|..|
  Fly   743 FDYRYGPTEQLKFVG 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4565NP_001097743.1 SET_SETMAR 16..267 CDD:380942 66/210 (31%)
E(z)NP_001261682.1 PRC2_HTH_1 151..291 CDD:436286
SANT 452..492 CDD:238096
preSET_CXC 579..610 CDD:408079 13/48 (27%)
SET_EZH2 628..747 CDD:380995 46/131 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.