DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4565 and Ehmt1

DIOPT Version :10

Sequence 1:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_006233681.2 Gene:Ehmt1 / 362078 RGDID:1307588 Length:1309 Species:Rattus norvegicus


Alignment Length:260 Identity:84/260 - (32%)
Similarity:126/260 - (48%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LESVLMPSDGSKEFKFLAD---------EYNSVLLNPCHCKGACENSE-VCAHGGQYE----FTE 72
            ::|.|.|::    :|:::.         :.|...|..|.|...|.:|. :|   ||..    :.:
  Rat  1040 VDSELCPTN----YKYVSQNCVTSPMNIDRNITHLQYCVCVDDCSSSTCMC---GQLSMRCWYDK 1097

  Fly    73 DGSELILRNSANP--VIECNDMCKCCRNTCSNRLVYSGPRKHLEIFDSPVYGSKGLRTTAKITKG 135
            ||..|...|.|.|  :.|||..|.|.|| |.||:|.:|.|..|:::.:...| .|:|:...|..|
  Rat  1098 DGRLLPEFNMAEPPLIFECNHACSCWRN-CRNRVVQNGLRARLQLYRTQDMG-WGVRSLQDIPLG 1160

  Fly   136 GYICEYAGELLTVPEARSRLHDNEKLGLMNYILVLNEYTSDKKQQVTIVDPSRRGNIGRYLNHSC 200
            .::|||.|||::..||..|..|       :|:..|:    :|..:|..:|....||:.|::||.|
  Rat  1161 TFVCEYVGELISDSEADVREED-------SYLFDLD----NKDGEVYCIDARFYGNVSRFINHHC 1214

  Fly   201 EPNCHIAAVRI-----DCPIPKIGIFAARDIAAKEELCFHYGGEGQYKKMTGGK--TCLCGASKC 258
            |||  :..||:     |...|:|..|:.|.|.|.|:|.|.||......|   ||  :|.||:.||
  Rat  1215 EPN--LVPVRVFMSHQDLRFPRIAFFSTRLIQAGEQLGFDYGERFWDVK---GKLFSCRCGSPKC 1274

  Fly   259  258
              Rat  1275  1274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4565NP_001097743.1 SET_SETMAR 16..267 CDD:380942 84/260 (32%)
Ehmt1XP_006233681.2 EHMT_ZBD 527..657 CDD:411018
ANKYR 731..987 CDD:440430
ANK repeat 785..814 CDD:293786
ANK repeat 816..847 CDD:293786
ANK repeat 849..881 CDD:293786
ANK repeat 883..914 CDD:293786
ANK repeat 916..947 CDD:293786
ANK repeat 949..980 CDD:293786
SET_EHMT1 1047..1277 CDD:380933 81/253 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.