DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4565 and Setd1b

DIOPT Version :10

Sequence 1:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_006530300.1 Gene:Setd1b / 208043 MGIID:2652820 Length:1986 Species:Mus musculus


Alignment Length:161 Identity:42/161 - (26%)
Similarity:78/161 - (48%) Gaps:19/161 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NRLVYSGPRKHLEIFDSPVYGSKGLRTTAKITKGGYICEYAGELL--TVPEARSRLHDNEKLGLM 164
            |:|.:.  :|.|:...|.:: ..||.....|.....:.||.|:.:  .:.:.|.:.:::|.:| .
Mouse  1840 NQLKFR--KKKLKFCKSHIH-DWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIG-S 1900

  Fly   165 NYILVLNEYTSDKKQQVTIVDPSRRGNIGRYLNHSCEPNCHIAAVRIDCPIPKIGIFAARDIAAK 229
            :|:.        :....||:|.::.||..|::||||.|||:...:.::.. .||.|::.:.|...
Mouse  1901 SYMF--------RVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQ-KKIVIYSKQHINVN 1956

  Fly   230 EELCFHYGGEGQYKKMTGGKTCLCGASKCTG 260
            ||:.:.|....:..|:    .||||:..|.|
Mouse  1957 EEITYDYKFPIEDVKI----PCLCGSENCRG 1983

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG4565NP_001097743.1 SET_SETMAR 16..267 CDD:380942 42/161 (26%)
Setd1bXP_006530300.1 RRM_Set1B 100..192 CDD:409965