DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4565 and set-19

DIOPT Version :10

Sequence 1:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001379854.1 Gene:set-19 / 180834 WormBaseID:WBGene00020919 Length:953 Species:Caenorhabditis elegans


Alignment Length:206 Identity:54/206 - (26%)
Similarity:83/206 - (40%) Gaps:41/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PVIECNDMCKCCRNTCSNRLVYSGPRKHLEIFDSPVYGSKG--LRTTAKITKGGYICEYAGELLT 147
            |:..|::.|. ||..|....:....:.|.:.::......||  |.|..:|.||..:..:.||:  
 Worm   145 PMFACSEGCG-CRGDCDLNGLKDIDKDHDKKYNVTRRDGKGFCLFTMFQIEKGQPVLAFNGEI-- 206

  Fly   148 VPEARSRLHD-NEKLGLMNYILVLNE--------------YTSDKK-------QQVTIVDPSRRG 190
                 :..|. |:|..:..|.|.|:|              ...|.|       :....|:|..:|
 Worm   207 -----TGYHSINKKPAVEQYALQLSEGDPRLSSFIRDCNVLNKDYKDVLRNALETKLWVNPLEKG 266

  Fly   191 NIGRYLNHSCEPNCHIAAV---RIDCPIPKIGIFAARDIAAKEELCFHYGGEGQYKKMTGGKTCL 252
            |..|:|:|:|:.|..:..|   .......:|.:||...|.|..||.||||.:  ||:......||
 Worm   267 NCARFLSHACQANLELGRVFQGGFSFADVRIVLFAKETIPAGSELTFHYGPD--YKEKFLEDLCL 329

  Fly   253 CGASKCTGFMP 263
            |    .|.|:|
 Worm   330 C----YTCFVP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4565NP_001097743.1 SET_SETMAR 16..267 CDD:380942 54/206 (26%)
set-19NP_001379854.1 SET 175..322 CDD:214614 41/155 (26%)

Return to query results.
Submit another query.