DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4565 and EHMT2

DIOPT Version :10

Sequence 1:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_006715037.2 Gene:EHMT2 / 10919 HGNCID:14129 Length:1395 Species:Homo sapiens


Alignment Length:269 Identity:87/269 - (32%)
Similarity:129/269 - (47%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ESVLMPS----DGS---KEFKFLAD---------EYNSVLLNPCHCKGACENSE-VCAHGGQYE- 69
            |:|.:|.    ||.   :::|::::         :.|...|..|.|...|.:|. :|   ||.. 
Human  1116 ENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSSSNCLC---GQLSI 1177

  Fly    70 ---FTEDGSELILRNSANP--VIECNDMCKCCRNTCSNRLVYSGPRKHLEIFDSPVYGSKGLRTT 129
               :.:||..|...|...|  :.|||..|.|.|| |.||:|.||.:..|:::.:...| .|:|..
Human  1178 RCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRN-CKNRVVQSGIKVRLQLYRTAKMG-WGVRAL 1240

  Fly   130 AKITKGGYICEYAGELLTVPEARSRLHDNEKLGLMNYILVLNEYTSDKKQQVTIVDPSRRGNIGR 194
            ..|.:|.:||||.|||::..||..|..|       :|:..|:    :|..:|..:|....|||.|
Human  1241 QTIPQGTFICEYVGELISDAEADVREDD-------SYLFDLD----NKDGEVYCIDARYYGNISR 1294

  Fly   195 YLNHSCEPNCHIAAVRI-----DCPIPKIGIFAARDIAAKEELCFHYGG-----EGQYKKMTGGK 249
            ::||.|:||  |..||:     |...|:|..|::|||...|||.|.||.     :.:|      .
Human  1295 FINHLCDPN--IIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKY------F 1351

  Fly   250 TCLCGASKC 258
            ||.||:.||
Human  1352 TCQCGSEKC 1360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4565NP_001097743.1 SET_SETMAR 16..267 CDD:380942 87/269 (32%)
EHMT2XP_006715037.2 PHA03247 <126..382 CDD:223021
2A1904 <396..504 CDD:273344
EHMT_ZBD 598..727 CDD:411018
ANKYR 806..1072 CDD:440430
ANK repeat 864..893 CDD:293786
ANK repeat 928..960 CDD:293786
ANK repeat 962..993 CDD:293786
ANK repeat 1002..1033 CDD:293786
ANK repeat 1035..1066 CDD:293786
SET_EHMT2 1133..1371 CDD:380931 82/252 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.