DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad86C and PCDHB16

DIOPT Version :9

Sequence 1:NP_001247033.1 Gene:Cad86C / 41302 FlyBaseID:FBgn0261053 Length:1949 Species:Drosophila melanogaster
Sequence 2:NP_066008.2 Gene:PCDHB16 / 57717 HGNCID:14546 Length:776 Species:Homo sapiens


Alignment Length:733 Identity:166/733 - (22%)
Similarity:276/733 - (37%) Gaps:167/733 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 HDLIFPHKPGIIMIPEDAKRGTE------LDYVIARKNPLFQKPVYLELWGSPLFAIRQKIVSSE 307
            |..:|..|..|:.|||::..|||      ||..:...|....|.       ||....|  ::..|
Human   129 HSPMFTEKEMILKIPENSPLGTEFPLNHALDLDVGSNNVQNYKI-------SPSSHFR--VLIHE 184

  Fly   308 TTEGTVF----LLGPLDFEKQAMYHLTILANDAYAEPGQDSRNIAGMEIVVIVQDVQDQPPVFTS 368
            ..:|..:    |...||.|::....||:.|.|..:.|...:..:. :|:|    |:.|..|.|..
Human   185 FRDGRKYPELVLDKELDREEEPQLRLTLTALDGGSPPRSGTAQVR-IEVV----DINDNAPEFEQ 244

  Fly   369 APPVTKLPPGILPGDKILQVHAEDGDKGNPREVRYGLVSENNPFTSFFDINETSGEIFLMRPLED 433
            .....::|.....|..:..|.|.|.|.|...::.|.|...:...:...::|..:||:.|.:.: |
Human   245 PIYKVQIPENSPLGSLVATVSARDLDGGANGKISYTLFQPSEDISKTLEVNPMTGEVRLRKQV-D 308

  Fly   434 IAFITHVGDPVLLTVIAEEVKVGRDEPPALASTVQLAFFLPDRTNSPPYFENDHYVSRVDENAPH 498
            ...:|           :.||::...:...|:....|...:.|..::||........|.:.||:|.
Human   309 FEMVT-----------SYEVRIKATDGGGLSGKCTLLLQVVDVNDNPPQVTMSALTSPIPENSPE 362

  Fly   499 GTALTFVDPYVPRVYDDDTGKNGVFSLTLLNNNGTFEISPNVAERSAGFLIRVRDNSMLDYEQQQ 563
            .....|      .|.|.|:|.||. :::.:..:..|.:.|:|    ..|...|.:.: ||.|.:.
Human   363 IVVAVF------SVSDPDSGNNGK-TISSIQEDLPFLLKPSV----KNFYTLVTERA-LDREARA 415

  Fly   564 SVQFQILAQELGPATNLSALVNVTVYINDVNDNAPVFEQPAYSVELPENMTAGTKVVQVLATDPD 628
            .....:...::| ...|....|:||.|:|||||||.|.|.:|::.:.||.:....:..|.|||.|
Human   416 EYNITLTVTDMG-TPRLKTEHNITVQISDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRD 479

  Fly   629 SGLGGKVRYTAI--------LGYLNTSLNLDAETGLITVSTNKHGF-----DREVMPEYHLYVEA 680
            ||...:|.|:.:        |..| .|:|.|          |.|.|     |.|.:..:...|.|
Human   480 SGTNAQVTYSLLPPQDPHLPLASL-VSINAD----------NGHLFALRSLDYEALQAFEFRVGA 533

  Fly   681 RDMDGEGNRAQVPLIIKLIDVNDETPIFDKDLY----------EFILTHDLMGFTTTAVIHAEDK 735
            .|........:..:.:.::|.||.:|..   ||          |.:......|:..|.|: |.|.
Human   534 TDRGSPALSREALVRVLVLDANDNSPFV---LYPLQNGSAPCTELVPRAAEPGYLVTKVV-AVDG 594

  Fly   736 DATAPNNEVRYEIINGNYDNQFVLDKVTGEL-TVREKIHLRSKKNAKTRRRRQAGSDDEDTDIFI 799
            | :..|..:.|:::.......|.:....||: |.|    |.|:::|..:|               
Human   595 D-SGQNAWLSYQLLKATEPGLFGVWAHNGEVRTAR----LLSERDAAKQR--------------- 639

  Fly   800 LTARAYDLGVPVRFSTTTIRVYPPESRKRSVKFVVPGHNPDKAKTEETLSALSGGKVYIHNIRPL 864
            |.....|.|.|.|.:|.|:.|           .:|.|.:                       :|.
Human   640 LVVLVKDNGEPPRSATATLHV-----------LLVDGFS-----------------------QPF 670

  Fly   865 SPDEPGAKDIPAGNPGIKERSVVTATVIYDSSSVVD------ISEIQQRLSHHNNSYAI----MP 919
            .|       :|...||..:.:.:|..::...:||..      :..:..||...:.:.::    ||
Human   671 LP-------LPEAAPGQTQANSLTVYLVVALASVSSLFLFSVLLFVAVRLCRRSRAASVGRCSMP 728

  Fly   920 Q--------DTSSTDTLT 929
            :        |.|.|.||:
Human   729 EGPFPGRLVDVSGTGTLS 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad86CNP_001247033.1 Cadherin_repeat 260..361 CDD:206637 27/110 (25%)
Cadherin_repeat 372..469 CDD:206637 18/96 (19%)
Cadherin_repeat 487..596 CDD:206637 28/108 (26%)
Cadherin_repeat 605..703 CDD:206637 26/110 (24%)
Cadherin_repeat 728..820 CDD:206637 22/92 (24%)
PCDHB16NP_066008.2 Cadherin_2 32..112 CDD:285466
Cadherin_repeat 137..238 CDD:206637 28/114 (25%)
Cadherin_repeat 246..343 CDD:206637 20/108 (19%)
Cadherin_repeat 356..447 CDD:206637 27/103 (26%)
Cadherin_repeat 455..557 CDD:206637 27/112 (24%)
Cadherin_repeat 576..664 CDD:206637 25/119 (21%)
Cadherin_C_2 685..768 CDD:293101 12/62 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X20
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.