DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad86C and Pcdhga9

DIOPT Version :9

Sequence 1:NP_001247033.1 Gene:Cad86C / 41302 FlyBaseID:FBgn0261053 Length:1949 Species:Drosophila melanogaster
Sequence 2:NP_001032235.1 Gene:Pcdhga9 / 252895 RGDID:620729 Length:931 Species:Rattus norvegicus


Alignment Length:695 Identity:157/695 - (22%)
Similarity:263/695 - (37%) Gaps:159/695 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 EGTV----FLLGPLDFEKQAMYHLTILANDAYAEPGQDSRNIAGMEIVVIVQDVQDQPPVFTSAP 370
            :||:    .|...||.|::..:||.:.|:|     |.|.|..:...|.|.|.|..|..|.|....
  Rat   187 DGTINPELVLERTLDREEEPSHHLVLTASD-----GGDPRRSSTALIQVTVLDTNDNAPAFDQPV 246

  Fly   371 PVTKLPPGILPGDKILQVHAEDGDKGNPREVRYGLVSENNPFTSFFDINETSGEIFLMRPL--ED 433
            ...|:...:.||..:|.|.|.|.|:|...:|.|.....|...:..|.::|.:||:.:.:.|  |:
  Rat   247 NRVKVLENVAPGTLLLTVRASDPDEGANGKVTYKFRKMNEKQSLLFHLHENTGEMTVAKTLDYEE 311

  Fly   434 IAFITHVGDPVLLTVIAEEVKVGRDEPPALASTVQLAFFLPDRTNSPPYFENDHYVSRVDENAPH 498
            .:..              |:::..::...|....::...:.|..::.|........|.|.|:||.
  Rat   312 CSLY--------------EMEIQAEDGGGLKGRTKVVVTVEDVNDNRPEVTITSLFSPVREDAPP 362

  Fly   499 GTALTFVDPYVPRVYDDDTGKNGVFSLTLLNNNGTFEISPNVAERSAGFLIRVRDNSMLDYEQQQ 563
            ||.:...:     .:|.|:||||.. :..:..|.:|::     |.|.....|:....:||.|:..
  Rat   363 GTVIVLFN-----AHDQDSGKNGQV-VCSIQENPSFKL-----ENSVDDYYRLMTAQILDREKAS 416

  Fly   564 SVQFQILAQELGPATNLSALVNVTVYINDVNDNAPVFEQPAYSVELPENMTAGTKVVQVLATDPD 628
            .....:.|.:.| ..::|..|.:|:|:.|:|||.|.|.|.:|||.||||...||.:..|.|.|||
  Rat   417 EYNITVTATDRG-TPSMSTEVQITLYVADINDNPPAFSQTSYSVYLPENNPRGTSIFSVSAHDPD 480

  Fly   629 SGLGGKVRYTAILGY-----LNTSLNLDAETGLITVSTNKHGFDREVMPEYHLYVEARDMDGEGN 688
            .....||.|:.:...     |.:.::::::||::..   ...||.|......:.|:|.|......
  Rat   481 ENENAKVTYSLVENTIQGAPLTSYISINSDTGVLYA---LQSFDYEQFRNLQMQVKASDSGHPPL 542

  Fly   689 RAQVPLIIKLIDVNDETPIFDKDLYEFILTHDL-----------MGFTTTAVIHAEDKDATAPNN 742
            .:.|.|.:.|:|.||..|   |.||..:.|...           .|:..|.|: |.|:| :..|.
  Rat   543 SSNVSLSVFLLDQNDNAP---KILYPSLPTDGSTGVELAPRSAEAGYLVTKVV-AVDED-SGQNA 602

  Fly   743 EVRYEIINGNYDNQFVLDKVTGELTVREKIHLRSKKNAKTRRRRQAGSDDEDTDIFILTARAYDL 807
            .:.|.::..:....|.:...:||:           :.|:....|.|....       |.....|.
  Rat   603 WLSYRLLKASEPGLFTVGLRSGEV-----------RTARALLERDALKQS-------LVVAVQDH 649

  Fly   808 GVPVRFSTTTIRVYPPESRKRSVKFVVPGHNPDKAKTEETLSALSGGKVYIHNIRPLSPDEPGA- 871
            |.|...:|.|:.|...:|        :|....|       ||::|         .|..||.... 
  Rat   650 GQPPLSATVTLTVAVADS--------IPDILAD-------LSSIS---------TPADPDSDITL 690

  Fly   872 ----------------------------------KDIPAGNPGIKERSVVTATVIYDSSSVVDIS 902
                                              :|...|:.|:            .:|.:|.:.
  Rat   691 YLVVAVAVVSCVFLLFVLVLLALRLRRWHASSLLQDAIGGSTGV------------PTSHIVGVH 743

  Fly   903 EIQQRLSHHNNSYAIMPQDTSS---------TDTLTPLQTQYKAE 938
            .:|..|..::..:::.|....|         .|||...::..|:|
  Rat   744 GVQTFLQTYSQEFSLTPDSGKSHLIFPQPNYADTLISQESCGKSE 788

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad86CNP_001247033.1 Cadherin_repeat 260..361 CDD:206637 17/54 (31%)
Cadherin_repeat 372..469 CDD:206637 20/98 (20%)
Cadherin_repeat 487..596 CDD:206637 29/108 (27%)
Cadherin_repeat 605..703 CDD:206637 30/102 (29%)
Cadherin_repeat 728..820 CDD:206637 18/91 (20%)
Pcdhga9NP_001032235.1 Cadherin_2 30..112 CDD:285466
Cadherin_repeat 139..238 CDD:206637 17/55 (31%)
Cadherin_repeat 248..343 CDD:206637 21/108 (19%)
Cadherin_repeat 356..448 CDD:206637 28/103 (27%)
Cadherin_repeat 456..558 CDD:206637 31/104 (30%)
Cadherin_repeat 579..666 CDD:206637 21/106 (20%)
Cadherin_C_2 687..771 CDD:293101 9/95 (9%)
Cadherin_tail 808..>904 CDD:292596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X20
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.