DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14693 and Pka-R1

DIOPT Version :9

Sequence 1:NP_001262467.1 Gene:CG14693 / 41299 FlyBaseID:FBgn0037837 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001189150.1 Gene:Pka-R1 / 40305 FlyBaseID:FBgn0259243 Length:464 Species:Drosophila melanogaster


Alignment Length:210 Identity:52/210 - (24%)
Similarity:91/210 - (43%) Gaps:28/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 TPHVIRTIPERMK----LCKLFAKLTCLAGFSPKIRARLVPVVRLMPVD--AGRIIIRQSDAPIT 132
            |.:|.:.:|:..|    |.|..||....|......|:.:...  :.||:  ||..||:|.|....
  Fly   193 TNYVKKVVPKDYKTMNALSKAIAKNVLFAHLDESERSDIFDA--MFPVNHIAGENIIQQGDEGDN 255

  Fly   133 VFFVLTGEVHMIKNEKNQKGEGVVMGFLGAGDMMGDVELLEGIKRTHTFRAATYCELLVLFDYDF 197
            .:.:..|||.:..|.:       ::..:..|...|::.|:.|..|..|.||.|..:|..:....:
  Fly   256 FYVIDVGEVDVFVNSE-------LVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSY 313

  Fly   198 APIL-GAYM--TKIWEE---KKRALKALDYFDFLDDDQIVEACRYGRLKQFDPLDTIFCEDIGSM 256
            ..|| |:.:  .|::||   :...|::||.::.|.....:|.|      .||..:||..:.... 
  Fly   314 RRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETC------SFDDGETIVKQGAAG- 371

  Fly   257 TNVHFVLSGECLILQ 271
            .:.:.:|.|..::||
  Fly   372 DDFYIILEGCAVVLQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14693NP_001262467.1 Crp 90..>204 CDD:223736 29/116 (25%)
CAP_ED 97..204 CDD:237999 27/109 (25%)
Pka-R1NP_001189150.1 Crp 213..>339 CDD:223736 32/134 (24%)
CAP_ED 219..328 CDD:237999 28/117 (24%)
Crp 331..>442 CDD:223736 14/63 (22%)
CAP_ED 337..453 CDD:237999 14/57 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.