DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14693 and Pka-R2

DIOPT Version :9

Sequence 1:NP_001262467.1 Gene:CG14693 / 41299 FlyBaseID:FBgn0037837 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_523671.1 Gene:Pka-R2 / 36041 FlyBaseID:FBgn0022382 Length:377 Species:Drosophila melanogaster


Alignment Length:277 Identity:59/277 - (21%)
Similarity:94/277 - (33%) Gaps:102/277 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 RARLVPVVRLM---------------------PVDAGRIIIRQSDAPITVFFVLTGEVHMIKNEK 148
            |||||..|:.:                     .|..|..||||.|.....:.:.:|...:..|:|
  Fly   112 RARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDK 176

  Fly   149 -----NQKGEGVVMGFLGAGDMMGDVELLEGIKRTHTFRAAT----------------------- 185
                 |..|            :.|::.||..:.|..|.:|.|                       
  Fly   177 HINTYNHTG------------LFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRK 229

  Fly   186 ---YCELL-------VLFDYDFAPILGAYMTKIWEEKKRALK---ALDYFDFLD----------D 227
               |.|||       .|.:|:...:..|.::|.::..:|.:|   |.|...|::          |
  Fly   230 RKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQD 294

  Fly   228 DQIVEACRYGRLKQFDPLDTIFCED-------IGSMTNVHF--VLSGECLILQCLNIKVTMKRGK 283
            |..||..:.|:.:.|..|..:....       .|.:..:.|  |.:.|.|:..|::|   |||..
  Fly   295 DAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDI---MKRNI 356

  Fly   284 KVYDLLPASEGDVSKMF 300
            ..|      |..:.|:|
  Fly   357 DDY------ESQLVKIF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14693NP_001262467.1 Crp 90..>204 CDD:223736 31/157 (20%)
CAP_ED 97..204 CDD:237999 31/157 (20%)
Pka-R2NP_523671.1 DD_RII_PKA 11..49 CDD:213046
CAP_ED 124..233 CDD:237999 19/120 (16%)
CAP_ED 242..356 CDD:237999 26/116 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.