DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14692 and Spa17

DIOPT Version :9

Sequence 1:NP_650019.6 Gene:CG14692 / 41298 FlyBaseID:FBgn0037836 Length:2851 Species:Drosophila melanogaster
Sequence 2:NP_445934.1 Gene:Spa17 / 85244 RGDID:620154 Length:148 Species:Rattus norvegicus


Alignment Length:158 Identity:41/158 - (25%)
Similarity:74/158 - (46%) Gaps:29/158 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VPLSMVFNIIPEKLTDLIKQFIKAVLREKPDNIYIFAQEYFQRM--SKEKS--------GRIEYS 127
            :|.|.....||:...:|::...:.:|||:||||..||..||:.:  .:||:        .::|..
  Rat     3 IPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTSFDPAEWGAKVEDR 67

  Fly   128 KYSSYEKSLKDKEHLAPATKVTCECGRVLSANRKDVENTASVYTDNKLAEADQREFSSRISYIQS 192
            .|:::  :.||.|.   |.|  ||.....::.|:  |...:.:.::...|.:|.|         :
  Rat    68 FYNNH--AFKDPEQ---AEK--CEQEIAKASGRE--ETPVTPFEESTEEEREQEE---------A 114

  Fly   193 VVIIQRHFRRYLNERKIGRDK-DKCNSV 219
            .|.||..||.::...::.:.| ||..:|
  Rat   115 AVKIQSAFRGHVAREEVKKMKSDKSENV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14692NP_650019.6 DD_R_PKA 9..43 CDD:295380
DD_R_PKA 82..120 CDD:295380 14/39 (36%)
LRIF1 <1113..1428 CDD:292369
Spa17NP_445934.1 DD_CABYR_SP17 12..50 CDD:213047 14/37 (38%)
Adgb_C_mid-like <74..>143 CDD:412094 21/85 (25%)
IQ 114..132 CDD:197470 5/17 (29%)
IQ motif 116..134 CDD:412094 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007076
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.