DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14692 and CDKN2AIP

DIOPT Version :9

Sequence 1:NP_650019.6 Gene:CG14692 / 41298 FlyBaseID:FBgn0037836 Length:2851 Species:Drosophila melanogaster
Sequence 2:NP_060102.1 Gene:CDKN2AIP / 55602 HGNCID:24325 Length:580 Species:Homo sapiens


Alignment Length:576 Identity:141/576 - (24%)
Similarity:240/576 - (41%) Gaps:124/576 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1064 GKSKESLEDAGD-----ENRAVEEIIDIT-----------------ENDRSTLLENLPSSEKENS 1106
            |.:..|.::|.|     .||.::::|..:                 .:...::.|.:..::....
Human    51 GAASASTDEAADAESGTRNRQLQQLISFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTY 115

  Fly  1107 TSLDENPLPEKE---STSLD--EKPSSGTEKSTSLDEKSSSEKE----KSTSLDEKPSSEKE-KS 1161
            |:.||.....|:   |:|.:  |:||    |...::.|:||..|    |:::..|:.|:::| .|
Human   116 TTRDELVAKVKKRGISSSNEGVEEPS----KKRVIEGKNSSAVEQDHAKTSAKTERASAQQENSS 176

  Fly  1162 TSLDETPSSEKENSTSLDEKPSPEKESTSLDEKPSSGTEKSTSLDEKSSSE-KEKSTSLDEKPSS 1225
            |.:.....||..||.          .|:.:..:.||.::...|:..:|||. ..:.|:.....:|
Human   177 TCIGSAIKSESGNSA----------RSSGISSQNSSTSDGDRSVSSQSSSSVSSQVTTAGSGKAS 231

  Fly  1226 EKEKSTSLNERPSSEKENSTSLVE--NPSPEKEST-SLDEKPSSGTEKSTSLDENPSSEKEKSTS 1287
            |.|         :.:|..|.|.|.  ..|.....| |.|.:..||:.|.::|             
Human   232 EAE---------APDKHGSASFVSLLKSSVNSHMTQSTDSRQQSGSPKKSAL------------- 274

  Fly  1288 LNERPSSEKENSTSQDEKP------SSETEKSTSLDEKPSSEKEKSTSLDGKPSSEKEKSTSLDE 1346
              |..|:....|:|:.|.|      |||.|... |..||||| ..|:.|..|.|||...|:|:.:
Human   275 --EGSSASASQSSSEIEVPLLGSSGSSEVELPL-LSSKPSSE-TASSGLTSKTSSEASVSSSVAK 335

  Fly  1347 NPSSEKEKSTSLNERPSSEKENSTSLVENPSPEKESTSLDEKPSSGT-----EKSTSLD--ENPS 1404
            |.||   ..|||....||...|::.|....:.:..::.|..|.||.|     .|||||.  ...:
Human   336 NSSS---SGTSLLTPKSSSSTNTSLLTSKSTSQVAASLLASKSSSQTSGSLVSKSTSLASVSQLA 397

  Fly  1405 SEKEKSTSLNERPSSEKENSTSQDEKPSSEKEKSTLLDKNTDLMRDLIQVSQKVDEEMSKGKA-- 1467
            |:....||.::.||    .||||..: ||.|....|.:::       ::..|.....:.|..|  
Human   398 SKSSSQTSTSQLPS----KSTSQSSE-SSVKFSCKLTNED-------VKQKQPFFNRLYKTVAWK 450

  Fly  1468 AIAVVDL-PDINKGESVNSPLEKKPSSQE-----LEDIQAELSTDKETGEPYNLSAEKHSESETS 1526
            .:||... |::|.||.:|:.:|...::.:     |::: |:|..:|.:.|  ::..|...:|...
Human   451 LVAVGGFSPNVNHGELLNAAIEALKATLDVFFVPLKEL-ADLPQNKSSQE--SIVCELRCKSVYL 512

  Fly  1527 NKPNNTTSKEIEGEDSRDHTK-------VEPISKKTIETTDVVDVGLKGNDDPSKP 1575
            ......:.:..:...||:..|       |..|.|:....:::.|:.|.  |:.|:|
Human   513 GTGCGKSKENAKAVASREALKLFLKKKVVVKICKRKYRGSEIEDLVLL--DEESRP 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14692NP_650019.6 DD_R_PKA 9..43 CDD:295380
DD_R_PKA 82..120 CDD:295380
LRIF1 <1113..1428 CDD:292369 96/341 (28%)
CDKN2AIPNP_060102.1 XTBD 19..124 CDD:314776 11/72 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..356 76/269 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8375
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.