DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14692 and Spa17

DIOPT Version :9

Sequence 1:NP_650019.6 Gene:CG14692 / 41298 FlyBaseID:FBgn0037836 Length:2851 Species:Drosophila melanogaster
Sequence 2:XP_011240741.2 Gene:Spa17 / 20686 MGIID:1333778 Length:189 Species:Mus musculus


Alignment Length:141 Identity:30/141 - (21%)
Similarity:53/141 - (37%) Gaps:33/141 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1988 PTEPEIVNKLNSNDEHKVNLIPIHNQKVADYPEIIKEVQPEEPNDVLREAETESNTILLSDLTEK 2052
            |....:|.|.....:.|...:|.:..|..::|..::|.:.|:                       
Mouse    76 PLPASVVKKKRKKKKEKKKRLPSNEIKHWNHPHQLEEKEEEQ----------------------- 117

  Fly  2053 HKETNEMHKKGSQELASVSAEVEKPMDASKLPTENRRDEKQVVETISPPINLTQLSAEPKRVKEL 2117
                 |..:|..||||..|...|.|:...:..||..|::::........:....::.|  .||::
Mouse   118 -----EQVEKCEQELAKSSGREETPVTPFEESTEEEREQEEAAALKIQSLFRGHVARE--EVKKM 175

  Fly  2118 KSDGFQEIENL 2128
            |||   :.|||
Mouse   176 KSD---KNENL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14692NP_650019.6 DD_R_PKA 9..43 CDD:295380
DD_R_PKA 82..120 CDD:295380
LRIF1 <1113..1428 CDD:292369
Spa17XP_011240741.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007076
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.