DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14692 and F39H12.3

DIOPT Version :9

Sequence 1:NP_650019.6 Gene:CG14692 / 41298 FlyBaseID:FBgn0037836 Length:2851 Species:Drosophila melanogaster
Sequence 2:NP_508165.2 Gene:F39H12.3 / 185505 WormBaseID:WBGene00018214 Length:210 Species:Caenorhabditis elegans


Alignment Length:245 Identity:60/245 - (24%)
Similarity:93/245 - (37%) Gaps:61/245 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VPEGLRDLMKVYTKEVLREKPADLYGFSASFFN-MIVGEKSHQSVRKYEPVQTYETIMKNRIRQQ 72
            ||..||.:::...:||||.:|:|:..|...||: .:...:.::::.| :|. .||          
 Worm     9 VPHDLRPILEALAREVLRSQPSDVAEFGHMFFDEYLKHRRENRNILK-DPA-AYE---------- 61

  Fly    73 VPLSMVFNIIPEKLTDLIKQFIKAVLREKPDNIYIFAQEYFQRMSKEKSGRIEYSKYSSYEKSLK 137
                 ||.      .||.|:|.:.   |:|.:....|....|...|....|....||....:   
 Worm    62 -----VFR------ADLQKKFAEV---ERPASPMDTAATKIQAAFKGHLVRAHPEKYGMSTR--- 109

  Fly   138 DKEHLAPATKVTCECGRVLSANRKDVENTASV--YTDNKLAEADQREFSSRISYIQSVVIIQRHF 200
                       |....::.|||.|..:...||  ||    .:.|..|       .::...||...
 Worm   110 -----------TSSSEKLDSANNKKDQKRHSVGGYT----IDVDTPE-------DRAATKIQSEI 152

  Fly   201 RRYLNERKIGRDKDKCNSVDYVAAILLIQRQVRRYLAKKRVAE--LKNSR 248
            |.:|..:.:  ||.|....|   |...||..:|.:|.:|.:.|  |..||
 Worm   153 RGFLTRKHV--DKMKKEDTD---AATKIQAHIRGFLTRKHLDEQGLSPSR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14692NP_650019.6 DD_R_PKA 9..43 CDD:295380 13/34 (38%)
DD_R_PKA 82..120 CDD:295380 9/37 (24%)
LRIF1 <1113..1428 CDD:292369
F39H12.3NP_508165.2 DD_CABYR_SP17 9..47 CDD:213047 13/37 (35%)
COG5022 <142..>205 CDD:227355 18/61 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007076
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.