DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14687 and Spa17

DIOPT Version :9

Sequence 1:NP_650018.1 Gene:CG14687 / 41297 FlyBaseID:FBgn0037835 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_445934.1 Gene:Spa17 / 85244 RGDID:620154 Length:148 Species:Rattus norvegicus


Alignment Length:63 Identity:19/63 - (30%)
Similarity:32/63 - (50%) Gaps:13/63 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PSSP--ESASSLQSEESAAIKIQAGFRGYRVRKEIHRSSKNPHPRRNQRQRPKNNGLMENQNN 65
            |.:|  ||....:.:|.||:|||:.|||:..|:|:.:...:           |:..:.|.:||
  Rat    97 PVTPFEESTEEEREQEEAAVKIQSAFRGHVAREEVKKMKSD-----------KSENVKEEENN 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14687NP_650018.1 IQ 17..36 CDD:197470 10/18 (56%)
IQ 88..109 CDD:197470
IQ 112..132 CDD:279006
Spa17NP_445934.1 DD_CABYR_SP17 12..50 CDD:213047
Adgb_C_mid-like <74..>143 CDD:412094 16/56 (29%)
IQ 114..132 CDD:197470 10/17 (59%)
IQ motif 116..134 CDD:412094 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.