powered by:
Protein Alignment CG14687 and Spa17
DIOPT Version :9
Sequence 1: | NP_650018.1 |
Gene: | CG14687 / 41297 |
FlyBaseID: | FBgn0037835 |
Length: | 138 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_445934.1 |
Gene: | Spa17 / 85244 |
RGDID: | 620154 |
Length: | 148 |
Species: | Rattus norvegicus |
Alignment Length: | 63 |
Identity: | 19/63 - (30%) |
Similarity: | 32/63 - (50%) |
Gaps: | 13/63 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 PSSP--ESASSLQSEESAAIKIQAGFRGYRVRKEIHRSSKNPHPRRNQRQRPKNNGLMENQNN 65
|.:| ||....:.:|.||:|||:.|||:..|:|:.:...: |:..:.|.:||
Rat 97 PVTPFEESTEEEREQEEAAVKIQSAFRGHVAREEVKKMKSD-----------KSENVKEEENN 148
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.