DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14687 and IQD25

DIOPT Version :9

Sequence 1:NP_650018.1 Gene:CG14687 / 41297 FlyBaseID:FBgn0037835 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_194644.2 Gene:IQD25 / 829036 AraportID:AT4G29150 Length:399 Species:Arabidopsis thaliana


Alignment Length:83 Identity:32/83 - (38%)
Similarity:42/83 - (50%) Gaps:17/83 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 MENQNNTGNPRPSGEDQHTATENGGKSVEDRSATKIQAGFRGFLVRKKQKIATDAAVKIQAGFRG 124
            ::.|..:|   |.|         ||||.|.|:|.:||..|||:|.||..: |....|||||..||
plant   114 LQGQGKSG---PLG---------GGKSREHRAAMQIQCAFRGYLARKALR-ALRGVVKIQALVRG 165

  Fly   125 FKTRKE----LKQCEPIV 138
            |..|.:    |:..|.:|
plant   166 FLVRNQAAATLRSMEALV 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14687NP_650018.1 IQ 17..36 CDD:197470
IQ 88..109 CDD:197470 11/20 (55%)
IQ 112..132 CDD:279006 9/23 (39%)
IQD25NP_194644.2 IQ 129..151 CDD:197470 11/21 (52%)
DUF4005 <335..380 CDD:289921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.