DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14687 and F39H12.3

DIOPT Version :9

Sequence 1:NP_650018.1 Gene:CG14687 / 41297 FlyBaseID:FBgn0037835 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_508165.2 Gene:F39H12.3 / 185505 WormBaseID:WBGene00018214 Length:210 Species:Caenorhabditis elegans


Alignment Length:139 Identity:51/139 - (36%)
Similarity:71/139 - (51%) Gaps:35/139 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PSSPESASSLQSEESAAIKIQAGFRGYRVRKEIHRSSKNPHPRR-NQRQRPKNNGLMENQNNTGN 68
            |:||        .::||.||||.|:|:.||         .||.: ....|..::..:::.||   
 Worm    77 PASP--------MDTAATKIQAAFKGHLVR---------AHPEKYGMSTRTSSSEKLDSANN--- 121

  Fly    69 PRPSGEDQHTATENGGKSV-----EDRSATKIQAGFRGFLVR----KKQKIATDAAVKIQAGFRG 124
              ...:.:|:.   ||.::     |||:|||||:..||||.|    |.:|..||||.||||..||
 Worm   122 --KKDQKRHSV---GGYTIDVDTPEDRAATKIQSEIRGFLTRKHVDKMKKEDTDAATKIQAHIRG 181

  Fly   125 FKTRKELKQ 133
            |.|||.|.:
 Worm   182 FLTRKHLDE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14687NP_650018.1 IQ 17..36 CDD:197470 10/18 (56%)
IQ 88..109 CDD:197470 14/24 (58%)
IQ 112..132 CDD:279006 14/19 (74%)
F39H12.3NP_508165.2 DD_CABYR_SP17 9..47 CDD:213047
COG5022 <142..>205 CDD:227355 29/49 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E3QN
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I3960
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto18968
orthoMCL 1 0.900 - - OOG6_122480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17026
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.750

Return to query results.
Submit another query.