DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcm5 and Mcm2

DIOPT Version :9

Sequence 1:NP_524308.2 Gene:Mcm5 / 41296 FlyBaseID:FBgn0017577 Length:733 Species:Drosophila melanogaster
Sequence 2:NP_477121.1 Gene:Mcm2 / 40973 FlyBaseID:FBgn0014861 Length:887 Species:Drosophila melanogaster


Alignment Length:637 Identity:217/637 - (34%)
Similarity:349/637 - (54%) Gaps:50/637 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VKKKYKEFIRTFNEENFFYKYRDTLKRNYLNGRYFLEIEMEDLVGFDETLADKLNKQPTEHLEIF 94
            :..:::.|:|||.:|...|.|||.::|..........:...||...:..||..|.:.|.:.||||
  Fly   180 IANRFQSFLRTFVDERGAYTYRDRIRRMCEQNMSSFVVSYTDLANKEHVLAYFLPEAPFQMLEIF 244

  Fly    95 EEAAREVADEITAPRPEHEEHMHDIQILLSSNANPTNIRQLKSDCVSKLVKIAGIIVAASGISAK 159
            ::.|:   |.:.:..|.:|....:|.:.:|.......:|..:...:::||:..|::.|.:|:..:
  Fly   245 DKVAK---DMVLSIFPTYERVTTEIHVRISELPLIEELRTFRKLHLNQLVRTLGVVTATTGVLPQ 306

  Fly   160 ATRMSIQCLSCSTVI------PNLKVNPGLEGYALPRKCNTEQAGRPKC-PLDPFFIMPDKCKCV 217
            .:.:...|:.|..|:      .|.::.||        .|       |:| ...||.|..::....
  Fly   307 LSVIKYDCVKCGYVLGPFVQSQNTEIKPG--------SC-------PECQSTGPFSINMEQTLYR 356

  Fly   218 DFQTLKLQELPDFVPQGEIPRHLQLFCDRSLCERVVPGNRVLIQGIYSIRKVGKPSRRDGREKAV 282
            ::|.:.|||.|..:|.|.|||...:.....||::..||:.:.:.|||:....|..:...|.....
  Fly   357 NYQKITLQESPGRIPAGRIPRSKDVILLADLCDQCKPGDELEVTGIYTNNYDGSLNTDQGFPVFA 421

  Fly   283 VGVRAPYMRVVGITVDSEGAGAISRYSNITSDEEEHFRRMAASGDIYERLSQSLAPSIFGSRDIK 347
            ..:.|.::    :..||:..     ..::|.::....::::....|.||:..|:||||:|...||
  Fly   422 TVIIANHV----VVKDSKQV-----VQSLTDEDIATIQKLSKDPRIVERVVASMAPSIYGHDYIK 477

  Fly   348 KAITCMLFGGSRKRLPDGLCRRGDINVLLLGDPGTAKSQLLKFVEKVAPIAVYTSGKGSSAAGLT 412
            :|:...||||..|...:....|||||:|:.|||||||||.||:.|||||.||:|:|:|:||.|||
  Fly   478 RALALALFGGESKNPGEKHKVRGDINLLICGDPGTAKSQFLKYTEKVAPRAVFTTGQGASAVGLT 542

  Fly   413 ASVMKDPQTRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS 477
            |.|.::|.:|.:.:|.||:||||.||..|||||||.:.||.:||||||||:|||:||||.|:|.:
  Fly   543 AYVRRNPVSREWTLEAGALVLADQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQA 607

  Fly   478 RCSVLAAANSIFGRWDDTKG-EENIDFMPTILSRFDMIFIVKDIHDESRDITLAKHIINVHLSSN 541
            ||:|:||||.|.||:|.:.. .||::....||||||::.:|||..|..:|..|||.:::.|:..:
  Fly   608 RCTVIAAANPIGGRYDPSMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQLAKFVVHSHMKHH 672

  Fly   542 KSAPSEPAEGEISLST--------FKKYIHYCRTHCGPRLSEAAGEKLKSRYVLMRSGAGQQEKA 598
            .|...:|...|..|.|        .::||.|.:.:..|:|:....:|:...|..:|    |:..|
  Fly   673 PSEEEQPELEEPQLKTVDEIPQDLLRQYIVYAKENIRPKLTNIDEDKIAKMYAQLR----QESFA 733

  Fly   599 SDKRLSIPITVRQLEAVIRISESLAKIRLQPFATDEHVNEALRLFQVSTLDA 650
            :.   |:|||||.:|:|||:||:.|::.|:....:..|:.|:|:...|.::|
  Fly   734 TG---SLPITVRHIESVIRMSEAHARMHLRENVMEADVSMAIRMMLESFIEA 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mcm5NP_524308.2 MCM_N 31..124 CDD:405270 25/92 (27%)
MCM 128..648 CDD:214631 190/535 (36%)
Mcm2NP_477121.1 MCM2_N 59..166 CDD:372227
MCM_N 184..270 CDD:379644 25/88 (28%)
MCM 276..780 CDD:214631 190/534 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469740
Domainoid 1 1.000 52 1.000 Domainoid score I661
eggNOG 1 0.900 - - E1_COG1241
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D15169at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11630
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.