DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and TMT1

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_011102.3 Gene:TMT1 / 856922 SGDID:S000000977 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:322 Identity:69/322 - (21%)
Similarity:106/322 - (32%) Gaps:103/322 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YHNKHLFQGKTVLDVGC--GTGILSMFAAKAGAAQVIAVDCS-NIIEFARQVVIDNNLQDVITVV 145
            ||:.   :.|.::||||  ||..|.|........|:|..|.| .:|:.|.  ||.....|....|
Yeast    32 YHDG---ERKLLVDVGCGPGTATLQMAQELKPFEQIIGSDLSATMIKTAE--VIKEGSPDTYKNV 91

  Fly   146 KGKI----------------EEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDG 194
            ..||                ::|::...:|     .:.|..:..|..|     .||.   |:|||
Yeast    92 SFKISSSDDFKFLGADSVDKQKIDMITAVE-----CAHWFDFEKFQRS-----AYAN---LRKDG 143

  Fly   195 M---------MFPDRGTLYITAIEDRQYKDEKINWWDDVYGFDMSCIRKVAVTEPLVDVVDPKQV 250
            .         :|||........||....|.....:|:..   ..|.:|.:.....|    ||:..
Yeast   144 TIAIWGYADPIFPDYPEFDDLMIEVPYGKQGLGPYWEQP---GRSRLRNMLKDSHL----DPELF 201

  Fly   251 ----VSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRN----DFVQALVTYFNIEFTKCHKRLGFS 307
                ||..|.....|     |..|:..:|..|.|::.    :|...:.|:               
Yeast   202 HDIQVSYFCAEDVRD-----KVKLHQHTKKPLLIRKQVTLVEFADYVRTW--------------- 246

  Fly   308 TSPDSTYTHWKQTVFYLDDHMTAKKNEE--------ITGTFQMKPNERNNRDLDFVIDINFK 361
                |.|..|||.          .||::        |..:.:.:|....|..::.|.:..:|
Yeast   247 ----SAYHQWKQD----------PKNKDKEDVADWFIKESLRRRPELSTNTKIEVVWNTFYK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 29/118 (25%)
TMT1NP_011102.3 AdoMet_MTases 33..>147 CDD:418430 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.