DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and CRG1

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_012079.1 Gene:CRG1 / 856616 SGDID:S000001252 Length:291 Species:Saccharomyces cerevisiae


Alignment Length:332 Identity:68/332 - (20%)
Similarity:119/332 - (35%) Gaps:99/332 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 MLKDEVRTVTYRNAMYHNK---------------HLFQGKTVLDVGCGTGILSMFAAKAGAAQVI 118
            |.|.......:.:|.|:|.               |....|:::|:||||| .:.|..:....:||
Yeast     1 MPKTSYLNKNFESAHYNNVRPSYPLSLVNEIMKFHKGTRKSLVDIGCGTG-KATFVVEPYFKEVI 64

  Fly   119 AVDCSN-IIEFARQVVIDNNLQDVITVVKGKIEEIELPNGI--EGVDIIIS-EWMGYCLFYESML 179
            .:|.|: ::..|.:...:..|...|..:....|::   :.|  |.||::|| |.:.:|     .|
Yeast    65 GIDPSSAMLSIAEKETNERRLDKKIRFINAPGEDL---SSIRPESVDMVISAEAIHWC-----NL 121

  Fly   180 DTVLYARDKWLKKDGMM------------FPDRGTLYITAIEDRQYKDEKINWWDDVYGFDMSCI 232
            :.:.......|:.||..            ||:...:|.           |..|..|..|..::..
Yeast   122 ERLFQQVSSILRSDGTFAFWFYIQPEFVDFPEALNVYY-----------KYGWSKDYMGKYLNDN 175

  Fly   233 RKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRNDFV-QALVTYFNI- 295
            ::    |.|::....|.....|....::::.....:|.|.|   ::..:.:.|: :|.:|.... 
Yeast   176 QR----EILLNYGGEKLRSLLSDRFGDIEVTIYSPSDPNAS---TVTAENSQFLWRAAITLNQFK 233

  Fly   296 EFTKCHKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQMKPNERNNRDLDFVIDINF 360
            ||.|..          |.||.|            |:.|..       ||:         :.|| |
Yeast   234 EFVKSW----------SIYTSW------------ARDNPS-------KPD---------IADI-F 259

  Fly   361 KGELSQI 367
            ..||.:|
Yeast   260 INELKEI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 25/103 (24%)
CRG1NP_012079.1 Methyltransf_11 43..140 CDD:400514 27/105 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.