DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and ERG6

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_013706.1 Gene:ERG6 / 855003 SGDID:S000004467 Length:383 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:47/246 - (19%)
Similarity:90/246 - (36%) Gaps:70/246 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASTDIPMEAA----------VESATGI----TPNSNANSNNVAKKLPA-EGSTGDNPNANADEM 50
            |:.|::....|          :...||:    :.|::|....|.|.|.. :|.|    :.:|:|.
Yeast     1 MSETELRKRQAQFTRELHGDDIGKKTGLSALMSKNNSAQKEAVQKYLRNWDGRT----DKDAEER 61

  Fly    51 TSRDYYFDSYAHFGI--------------HEEMLKDEVRTVTYRNAMYHNKH-------LFQGKT 94
            ...||...:::::.:              .....|.|    ::..::..::|       :.:|..
Yeast    62 RLEDYNEATHSYYNVVTDFYEYGWGSSFHFSRFYKGE----SFAASIARHEHYLAYKAGIQRGDL 122

  Fly    95 VLDVGCGTGILSMFAAKAGAAQVIAVDCSNI-IEFARQVVIDNNLQDVITVVKGKIEEIELPNG- 157
            |||||||.|..:...|:.....||.::.::. |..|:......||.|.:..|||...:::.... 
Yeast   123 VLDVGCGVGGPAREIARFTGCNVIGLNNNDYQIAKAKYYAKKYNLSDQMDFVKGDFMKMDFEENT 187

  Fly   158 ---------------IEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKD 193
                           :|||         |...|:.:.....:|..:|:..|
Yeast   188 FDKVYAIEATCHAPKLEGV---------YSEIYKVLKPGGTFAVYEWVMTD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 27/117 (23%)
ERG6NP_013706.1 Cfa 66..>277 CDD:225139 32/177 (18%)
Methyltransf_11 124..222 CDD:400514 23/106 (22%)
Sterol_MT_C 306..368 CDD:400686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.