DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and BUD23

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_009976.1 Gene:BUD23 / 850414 SGDID:S000000643 Length:275 Species:Saccharomyces cerevisiae


Alignment Length:299 Identity:59/299 - (19%)
Similarity:106/299 - (35%) Gaps:74/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YYFDSYAH-----FGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAKAGA 114
            :|.||.||     ..:.....|..:|.:...|       |.....:||:|||:|:......:.|.
Yeast    13 FYNDSEAHKYTGSTRVQHIQAKMTLRALELLN-------LQPCSFILDIGCGSGLSGEILTQEGD 70

  Fly   115 AQVIAVDCSNII---EFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYE 176
            .....:|.|..:   ..:|::..|..|||:.|.:..:....:....|..:     :|:  |....
Yeast    71 HVWCGLDISPSMLATGLSRELEGDLMLQDMGTGIPFRAGSFDAAISISAI-----QWL--CNADT 128

  Fly   177 SMLD---------TVLYARDKWLKKDG----MMFPDRGTLYITAIEDRQYKDEKINWWDDVYGFD 228
            |..|         ..|||.   |||.|    ..:|.              .|::::        |
Yeast   129 SYNDPKQRLMRFFNTLYAA---LKKGGKFVAQFYPK--------------NDDQVD--------D 168

  Fly   229 MSCIRKVAVTEPLVDVVDPKQ--------VVSTSCMVK-----EVDLYTVQKADLNFSSKFSLCI 280
            :....|||.....:.|.||:.        |:|:....:     .:|..|:.:.::|...:....:
Yeast   169 ILQSAKVAGFSGGLVVDDPESKKNKKYYLVLSSGAPPQGEEQVNLDGVTMDEENVNLKKQLRQRL 233

  Fly   281 KRNDFVQALVTYFNIEFTKCHKRLGFSTSPDSTYTHWKQ 319
            |.....::..: |.:...:..||.|...:.||.:|..|:
Yeast   234 KGGKDKESAKS-FILRKKELMKRRGRKVAKDSKFTGRKR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 26/111 (23%)
BUD23NP_009976.1 Methyltransf_25 51..152 CDD:404528 26/110 (24%)
WBS_methylT <226..273 CDD:403702 9/47 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.