DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and PRMT4A

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_199713.2 Gene:PRMT4A / 834961 AraportID:AT5G49020 Length:528 Species:Arabidopsis thaliana


Alignment Length:372 Identity:120/372 - (32%)
Similarity:183/372 - (49%) Gaps:46/372 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AVESATGITPNSNANSNNVAK---KLPAEGSTGDNPNANADEMTSRDYYFDSYAHFGIHEEMLKD 72
            ||:..:.: ||....|.|.:|   |:               |..|...||..|......:.||:|
plant   119 AVKQGSAL-PNGTVVSANKSKFDDKI---------------EAASAKMYFHYYGQLLHQQNMLQD 167

  Fly    73 EVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNN 137
            .|||.||..|:..|:..|.|:.|:|||.|:||||||||.|||..|.||:.|.:.|:||:::..|.
plant   168 YVRTGTYHAAVMENRSDFSGRVVVDVGAGSGILSMFAALAGAKHVYAVEASEMAEYARKLIAGNP 232

  Fly   138 -LQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRG 201
             |.:.|||:|||||:||||   |..|::|||.||..|..|.||:|.:.|||::|..:|.|||..|
plant   233 LLAERITVIKGKIEDIELP---EKADVLISEPMGTLLVNERMLETYVIARDRFLSPNGKMFPTVG 294

  Fly   202 TLYITAIEDRQYKDEKIN---WW--DDVYGFDMSCIRKVA----VTEPLVDVVDPKQVVSTS--- 254
            .:::....|.....|..|   :|  .:.||.|::.:...|    .::|:||..||:.:|:.|   
plant   295 RIHMAPFADEFLFVEMANKALFWQQQNYYGVDLTPLYVSAHQGYFSQPVVDAFDPRLLVAPSMFH 359

  Fly   255 ----CMVKEVDLYTVQKADLNFSSKFSLCIKRNDFVQALVTYFNIEFTKCHKRLGFSTSPDSTYT 315
                .|:.|...|.:   |:......|:|.:    :..|..:|::.|.....:..|:|:|.:..|
plant   360 VIDFTMMTEEQFYEI---DIPLKFTASVCTR----IHGLACWFDVLFDGSTVQRWFTTAPGAPTT 417

  Fly   316 HWKQTVFYLDDHMTAKKNEEITGTFQMKPNERNNRDLDFVIDINFKG 362
            ||.|....|...:.....:||||...:..:...:..::..:.....|
plant   418 HWYQIRCVLSQPIHVMAGQEITGRLHLIAHSAQSYTINLTLSAKMWG 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 53/100 (53%)
PRMT4ANP_199713.2 SmtA 140..400 CDD:223574 99/284 (35%)
AdoMet_MTases 160..>300 CDD:302624 70/142 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.