DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and PRMT4B

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_850528.1 Gene:PRMT4B / 819878 AraportID:AT3G06930 Length:535 Species:Arabidopsis thaliana


Alignment Length:377 Identity:123/377 - (32%)
Similarity:188/377 - (49%) Gaps:47/377 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EGSTGDNPNANAD--------EMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQG 92
            :||:..|...:|:        |.:|...||..|......:.||:|.|||.||..|:..|...|.|
plant   120 QGSSLQNGTVSANKSKFDNKIEASSAKMYFHYYGQLLHQQNMLQDYVRTGTYYAAVMENHSDFAG 184

  Fly    93 KTVLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNL-QDVITVVKGKIEEIELPN 156
            :.|:|||.|:||||||||:|||..|.||:.|.:.|:||:::..|.| .|.|||:|||:|:|||| 
plant   185 RVVVDVGAGSGILSMFAAQAGAKHVYAVEASEMAEYARKLIAGNPLFADRITVIKGKVEDIELP- 248

  Fly   157 GIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKIN-- 219
              |..||:|||.||..|..|.||::.:.|||:::...|.|||..|.:::....|.....|..|  
plant   249 --EKADILISEPMGTLLVNERMLESYVIARDRFMTPKGKMFPTVGRIHMAPFSDEFLFIEMANKA 311

  Fly   220 -WW--DDVYGFDMSCIRKVA----VTEPLVDVVDPKQVVSTS-------CMVKEVDLYTVQKADL 270
             :|  .:.||.|::.:...|    .::|:||..||:.:|::.       ..:||.|.|.:   |:
plant   312 MFWQQQNYYGVDLTPLYGSAHQGYFSQPVVDAFDPRLLVASPMFHMIDFTQMKEEDFYEI---DI 373

  Fly   271 NFSSKFSLCIKRNDFVQALVTYFNIEFTKCHKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEE 335
            ......|:|.:    :..|..:|::.|.....:...:|:|.:..|||.|....|...:.....:|
plant   374 PLKFTASMCTR----MHGLACWFDVLFDGSTVQRWLTTAPGAPTTHWYQIRCVLSQPIYVMAGQE 434

  Fly   336 ITGTFQMKPNERNNRDLDFVIDINFKGE-LSQ--IQESNT---------YRM 375
            |||...:..:...:..:|..:.....|. .||  |.:|:|         |||
plant   435 ITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQSSTCKFDLKEPYYRM 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 52/100 (52%)
PRMT4BNP_850528.1 AdoMet_MTases 157..>297 CDD:302624 69/142 (49%)
PRMT5 <186..436 CDD:282971 89/259 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.