DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and NDUFAF5

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_077025.2 Gene:NDUFAF5 / 79133 HGNCID:15899 Length:345 Species:Homo sapiens


Alignment Length:392 Identity:80/392 - (20%)
Similarity:125/392 - (31%) Gaps:121/392 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PNSNANSNNVAKKLPAEGSTG---------------DNPNANADEMTSRDYYFDSYAHFGIHEEM 69
            |..|.....|...:...|||.               .|..|...|.|..||              
Human    20 PAENLGRREVTSGVSPRGSTSPRTLNIFDRDLKRKQKNWAARQPEPTKFDY-------------- 70

  Fly    70 LKDEVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVI 134
            ||:||.: ...:.:|.....|  ...||:|||.|.::.:..|....:....|   |.|.|    :
Human    71 LKEEVGS-RIADRVYDIPRNF--PLALDLGCGRGYIAQYLNKETIGKFFQAD---IAENA----L 125

  Fly   135 DNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPD 199
            .|:.:..|..|....:|..||......|:::|   ...|.:.:.|...|......||.||:..  
Human   126 KNSSETEIPTVSVLADEEFLPFKENTFDLVVS---SLSLHWVNDLPRALEQIHYILKPDGVFI-- 185

  Fly   200 RGTLYITAIEDRQYKDEKINWWDDVYGFDMSCIRKVAVTE----------PLVDVVDPKQVVSTS 254
             |.::               ..|.:|  ::.|..::|.||          |...|.|...::..:
Human   186 -GAMF---------------GGDTLY--ELRCSLQLAETEREGGFSPHISPFTAVNDLGHLLGRA 232

  Fly   255 CM-VKEVDLYTVQKADLNFSSKFSL-----------C-------IKRNDFVQALVTYFNIEFTKC 300
            .. ...||...:|   :|:...|.|           |       :.|:..:.|...|..:...: 
Human   233 GFNTLTVDTDEIQ---VNYPGMFELMEDLQGMGESNCAWNRKALLHRDTMLAAAAVYREMYRNE- 293

  Fly   301 HKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQMKPNERNNRDLDFVIDINFKGELS 365
                  ..|..:||     .::|    |...|..|    .|.:|.||.:..:.|       |||.
Human   294 ------DGSVPATY-----QIYY----MIGWKYHE----SQARPAERGSATVSF-------GELG 332

  Fly   366 QI 367
            :|
Human   333 KI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 24/99 (24%)
NDUFAF5NP_077025.2 BioC 74..310 CDD:273953 55/287 (19%)
Methyltransf_11 94..185 CDD:285453 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.