DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and prmt2

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_012826019.1 Gene:prmt2 / 780163 XenbaseID:XB-GENE-980934 Length:634 Species:Xenopus tropicalis


Alignment Length:351 Identity:113/351 - (32%)
Similarity:191/351 - (54%) Gaps:15/351 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NNVAKKLPA---EGSTGDNPNANADEMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKH 88
            |.:...:||   ..:..|..:...|:....:.|:.||....:|.|||.|..||..|:..:..|..
 Frog   274 NGICGYVPASYLHDALNDQEDTEVDDPWQDEEYYGSYKTLKLHLEMLSDVPRTTAYKEVILRNSS 338

  Fly    89 LFQGKTVLDVGCGTGILSMFAAK-AGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEI 152
            ...||.:||:||||||:|.|.|| |....|.||:.|.|.|..|::|..|.:.:::.|::.:.||:
 Frog   339 SLCGKHILDLGCGTGIISFFCAKLAQPEAVYAVEASEIAEQTRRLVKQNGISNLVHVIRQRAEEL 403

  Fly   153 ELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEK 217
            :||.   .|||::|||||.||.:|.||::||.|||:|||:||:|:|....:::......:....|
 Frog   404 QLPT---KVDILVSEWMGTCLLFEFMLESVLQARDRWLKEDGVMWPSTACIHLVPCSASKEYANK 465

  Fly   218 INWWDDVYGFDMSCIRKVAVTE----PLVD-VVDPKQVVSTSCMVKEVDLYTVQKADL-NFSSKF 276
            :.:||:.|..|.|.::.:|..|    |..| |:.|:..:|..|::..::|.|:|.|:| ..:|.|
 Frog   466 VLFWDNPYQLDFSLLKPLAAKEFFARPKPDYVLQPEDCLSEPCILLHLNLKTLQLAELERMNSDF 530

  Fly   277 SLCIKRNDFVQALVTYFNIEFTKCHK--RLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGT 339
            :..:..:..:.....:|:::|....:  :|..:|.|.|..||||.|:|.||:.:..:|.::|:|:
 Frog   531 TFFVHTDGLLHGFTAWFSVQFQNLEEQGQLELNTGPFSPLTHWKHTLFMLDEPLQVQKGDKISGS 595

  Fly   340 FQMKPNERNNRDLDFVIDINFKGELS 365
            ...:.|....|.:...:.....|:|:
 Frog   596 VVFQRNSVWRRHMSVTLSWVINGKLT 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 48/100 (48%)
prmt2XP_012826019.1 2A1904 <22..>232 CDD:273344
SH3 235..287 CDD:388381 3/12 (25%)
Methyltransf_25 345..442 CDD:379312 48/99 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.