DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Prmt3

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_598501.1 Gene:Prmt3 / 71974 MGIID:1919224 Length:528 Species:Mus musculus


Alignment Length:384 Identity:167/384 - (43%)
Similarity:228/384 - (59%) Gaps:37/384 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PNSNANSNNVAKK--------LPAEGS-------------------------TGDNPNANADEMT 51
            ||..:.|.:|.:|        |.||.:                         |..:....||...
Mouse   147 PNGLSESASVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMNVDVRTCSSTTTIADLQE 211

  Fly    52 SRD-YYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAKAGAA 115
            ..| .||.||.|:|||||||||:|||.:||:.:|.|.|:|:.|.|||||||||||||||||.||.
Mouse   212 DEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKVGAK 276

  Fly   116 QVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESMLD 180
            :|||||.|.|:..|..::..|.|:|.|.::||||||:.||  :|.||:||||||||.|.:|||||
Mouse   277 KVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLP--VEKVDVIISEWMGYFLLFESMLD 339

  Fly   181 TVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDVYGFDMSCIRKVAVTEPLVDVV 245
            :||||:.|:|.|.|.::||..|:.:.|:.|.....::|.:|||||||:|||::|..:.|.:|:||
Mouse   340 SVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVV 404

  Fly   246 DPKQVVSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRNDFVQALVTYFNIEFTK-CHKRLGFSTS 309
            |.|.::|..|.:|.:|.:|...:||.|||.|:|...:.....|:..||:|.|.| ||.|:.|||.
Mouse   405 DHKTLISDPCDIKHIDCHTTSISDLEFSSDFTLRTTKTAMCTAVAGYFDIYFEKNCHNRVVFSTG 469

  Fly   310 PDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQMKPNERNNRDLDFVIDINFKGELSQIQ 368
            |.||.||||||||.|:.....|..|.:.|...:..|:::.|.|...:.:|...:...:|
Mouse   470 PQSTKTHWKQTVFLLEKPFPVKAGEALKGKITVHKNKKDPRSLIVTLTLNSSTQTYSLQ 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 63/99 (64%)
Prmt3NP_598501.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
zf-C2H2_2 48..>97 CDD:289522
AdoMet_MTases 256..356 CDD:100107 64/101 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.