DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Alkbh8

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006509942.1 Gene:Alkbh8 / 67667 MGIID:1914917 Length:709 Species:Mus musculus


Alignment Length:163 Identity:33/163 - (20%)
Similarity:60/163 - (36%) Gaps:38/163 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 MLKDE-VRTVTYRNAMYHNKHLFQGKTVLDVGCGTGI----LSMFAAKAGAAQVIAVDCSNIIEF 128
            :||.| ::.|:|..         |...:.:.|.|.|:    |.:...|.|..:.:.:..:....|
Mouse    74 LLKHEGIQAVSYPT---------QSLVIANGGLGNGVSRKQLLLTLEKCGPVEALLMPPNKPYAF 129

  Fly   129 ARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKD 193
            .....|:.:.:...|:           ||.|.:|.:..:...|..|.|         :.:| |..
Mouse   130 VIFQTIEESKKAYFTL-----------NGKEIIDDLGQKIFLYLNFVE---------KAQW-KNM 173

  Fly   194 GMMFPDRGTLYITAI---EDRQYKDEKINWWDD 223
            |:.....|.|.:..|   |:.:...|.:||.:|
Mouse   174 GLEALPPGLLVVEEIISSEEEKKLLESVNWTED 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 18/103 (17%)
Alkbh8XP_006509942.1 DUF1891 46..82 CDD:117570 3/7 (43%)
RRM_ALKBH8 87..167 CDD:240877 17/108 (16%)
2OG-FeII_Oxy 197..379 CDD:389772 4/10 (40%)
Methyltransf_25 455..542 CDD:379312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.