DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Bud23

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_030110611.1 Gene:Bud23 / 66138 MGIID:1913388 Length:300 Species:Mus musculus


Alignment Length:291 Identity:44/291 - (15%)
Similarity:84/291 - (28%) Gaps:128/291 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 QGKTVLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQ-DVITVVKGKIEEIEL 154
            |...:||:|||:|:...:.::.|...| .:|.|..:   ....:|.:.: |::....|:..... 
Mouse    72 QPSYLLDIGCGSGLSGDYISEEGHYWV-GIDISPAM---LDAALDRDTEGDLLLGDMGQGVPFR- 131

  Fly   155 PNGIEG-VDIIISEWMG-------------YCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYI 205
            |...:| :.|...:|:.             || |:.|:...::......|:    ::|:..    
Mouse   132 PGSFDGCISISAVQWLCNANKKSDVPARRLYC-FFSSLYSALVRGARAVLQ----LYPENS---- 187

  Fly   206 TAIEDRQYKDEKINWWDDVYGFDMSCIRKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADL 270
                                                                ::::|.|.|....
Mouse   188 ----------------------------------------------------EQLELITTQATRA 200

  Fly   271 NF-------------SSKFSLCI-------------KRNDFVQALVTYFN--------------- 294
            .|             :.||.||:             :..|..||..:.|.               
Mouse   201 GFTGGVVVDFPNSAKAKKFYLCLFSGPSTSLPKGLTESQDADQASESMFTSERAPHKKARRDLVK 265

  Fly   295 ------IEFTKCHKRLGFSTSPDSTYTHWKQ 319
                  :|..:..:|.|....||:.||..|:
Mouse   266 KSREWVLEKKERRRRQGKEVRPDTQYTGRKR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 22/114 (19%)
Bud23XP_030110611.1 UbiG 37..>110 CDD:225137 11/41 (27%)
Methyltransf_11 77..>147 CDD:369777 16/74 (22%)
WBS_methylT 223..298 CDD:372208 12/74 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.