DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and bud23

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001076348.1 Gene:bud23 / 572367 ZFINID:ZDB-GENE-070410-68 Length:282 Species:Danio rerio


Alignment Length:201 Identity:41/201 - (20%)
Similarity:73/201 - (36%) Gaps:68/201 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 VLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIE 159
            :||||||:|:...:.::||...| .||.|.       .::|                :.|...:|
Zfish    57 LLDVGCGSGLSGDYLSEAGHYWV-GVDIST-------AMLD----------------VALEREVE 97

  Fly   160 GVDIIISEWMGYCL-FYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKINWWDD 223
            | |:::.: ||..: |...|.|                    |.:.|:|::.....|:|.:....
Zfish    98 G-DLLLGD-MGEGMPFRPGMFD--------------------GCISISALQWLCNADKKTHSPPK 140

  Fly   224 -VYGFDMSCIRKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADLNF-------------SS 274
             :|.|..:....:|.....|..:.|:.       .::::|.|.|.....|             :.
Zfish   141 RLYRFFSTLYSSLARGARAVFQIYPEN-------SEQLELITAQAMKAGFTGGMVVDYPNSSKAK 198

  Fly   275 KFSLCI 280
            ||.||:
Zfish   199 KFFLCL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 23/99 (23%)
bud23NP_001076348.1 Methyltransf_11 58..133 CDD:285453 26/120 (22%)
WBS_methylT 204..280 CDD:289366 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.