Sequence 1: | NP_650017.1 | Gene: | Art1 / 41295 | FlyBaseID: | FBgn0037834 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076348.1 | Gene: | bud23 / 572367 | ZFINID: | ZDB-GENE-070410-68 | Length: | 282 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 41/201 - (20%) |
---|---|---|---|
Similarity: | 73/201 - (36%) | Gaps: | 68/201 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 VLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIE 159
Fly 160 GVDIIISEWMGYCL-FYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKINWWDD 223
Fly 224 -VYGFDMSCIRKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADLNF-------------SS 274
Fly 275 KFSLCI 280 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Art1 | NP_650017.1 | AdoMet_MTases | 94..194 | CDD:100107 | 23/99 (23%) |
bud23 | NP_001076348.1 | Methyltransf_11 | 58..133 | CDD:285453 | 26/120 (22%) |
WBS_methylT | 204..280 | CDD:289366 | 0/1 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |