Sequence 1: | NP_650017.1 | Gene: | Art1 / 41295 | FlyBaseID: | FBgn0037834 | Length: | 376 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001107079.1 | Gene: | si:dkey-190g11.3 / 567059 | ZFINID: | ZDB-GENE-081104-341 | Length: | 215 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 43/195 - (22%) |
---|---|---|---|
Similarity: | 68/195 - (34%) | Gaps: | 83/195 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 RTVTYRNAMYHNKHLFQGKT--VLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIE-FARQVVIDN 136
Fly 137 NLQDV----------------------ITV--------VKGKIEEIELPNGIEGVDIIISEWMGY 171
Fly 172 CLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDVYGFDMSCIRKVA 236
Fly 237 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Art1 | NP_650017.1 | AdoMet_MTases | 94..194 | CDD:100107 | 24/132 (18%) |
si:dkey-190g11.3 | NP_001107079.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |