DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and prmt9

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001124239.1 Gene:prmt9 / 553290 ZFINID:ZDB-GENE-080728-4 Length:859 Species:Danio rerio


Alignment Length:353 Identity:80/353 - (22%)
Similarity:153/353 - (43%) Gaps:68/353 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 HEEMLKDEVRTVTYRNAMYHNKHLFQG--KTVLDVGCGTGILSMFAAKAGAAQVIAVDCS-NIIE 127
            |..||.|..|...|:.|:   |...:|  .:|||:|.|||||.|.|..||||:|.|.:.| .:.|
Zfish   156 HFLMLNDHGRNHKYQLAI---KKAVEGGCSSVLDIGTGTGILGMCAKMAGAAEVYACELSKTMYE 217

  Fly   128 FARQVVIDNNLQDVITVVKGKIEEIELPNGIEG-VDIIISEWMGYCLFYESMLDTVLYARDKWL- 190
            .|.:|:..|.:.|.|.::..|..::|:|..|.. |.::::|.:...||.|.:::|:::|....| 
Zfish   218 LACEVLSANGMADCIKILHRKSLDMEIPKDIPNRVSLVVTETVDAGLFGEGIIETLIHAWKHLLL 282

  Fly   191 ------------KKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDVYGFDMSCIRKV-AVTEPLV 242
                        .:.|.:.|...|::..|::..:.:.........|.|.|:|.:.:: :....|.
Zfish   283 PPPNPGELLSSPSQTGRVIPAGATVFGVAVQCPEIRRHHRLCVSSVGGLDLSAVGQIYSPVSCLA 347

  Fly   243 DVVDPKQVVSTSCMVK---------------EVDLYTVQKADLNFSS---KFSLCIKRNDFVQAL 289
            |..|..:..:|..:.:               ::|...||:.:...|.   :..||:.::..:.||
Zfish   348 DTEDSTEPYTTERLSRLRGGYIQLTQPFTALDIDFNNVQELEGLCSREVVQLCLCVTQDGILDAL 412

  Fly   290 VTYFNIEFTKCHKRLGFSTSPDSTYTHWKQTVFYLDDHM-TAKKNEEITGTFQMKPNERNNRDLD 353
            ..:|.:...:.:.   .||.|... |.|:|.::.:.... :.|:.:||                 
Zfish   413 AVWFQLHLDQDNH---LSTGPQEE-TCWEQAIYPVQSTFNSVKRGDEI----------------- 456

  Fly   354 FVIDINFKGE------LSQIQESNTYRM 375
             :::::.|..      ::.|::.||..|
Zfish   457 -LVEVSCKDSYLRLCCVAIIRDGNTIHM 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 36/114 (32%)
prmt9NP_001124239.1 TPR_11 72..135 CDD:290150
TPR repeat 72..98 CDD:276809
MAS20 <96..133 CDD:295844
TPR repeat 103..133 CDD:276809
AdoMet_MTases 151..>267 CDD:302624 41/113 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.