DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Prmt2

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001020315.1 Gene:Prmt2 / 499420 RGDID:1565519 Length:445 Species:Rattus norvegicus


Alignment Length:300 Identity:104/300 - (34%)
Similarity:173/300 - (57%) Gaps:13/300 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAA-KAGAAQVIA 119
            |||||....:|.|||.|:.||..|.:.:..||...:.|.:|||||||||:|:|.| .|....|.|
  Rat   114 YFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPKAVYA 178

  Fly   120 VDCSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLY 184
            |:.|::.:...|:|:.|...|.|||.:.|:|::.||   |.||:::|||||.||.:|.|::::||
  Rat   179 VEASDMAQHTGQLVLQNGFADTITVFQQKVEDVVLP---EKVDVLVSEWMGTCLLFEFMIESILY 240

  Fly   185 ARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDVYGFDMSCIRKVAVTE----PLVD-V 244
            |||.|||:||:::|....|::......:....|:.:||:.|.|::|.::.:|:.|    |..: :
  Rat   241 ARDAWLKEDGIIWPTTAALHLVPCSAEKDYHSKVLFWDNAYEFNLSALKSLAIKEFFSRPKSNHI 305

  Fly   245 VDPKQVVSTSCMVKEVDLYTVQKADL-NFSSKFSLCIKRNDFVQALVTYFNIEFTKCHK---RLG 305
            :.|:..:|..|.:.::|:.|||.:|| ....:....|::...:.....:|::.|....:   :..
  Rat   306 LKPEDCLSEPCTILQLDMRTVQVSDLETMRGELRFDIQKAGTLHGFTAWFSVHFQSLEEGQPQQV 370

  Fly   306 FSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQMKPN 345
            .||.|....||||||:|.:||.:.....:.:||:..::.|
  Rat   371 LSTGPLHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRN 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 48/100 (48%)
Prmt2NP_001020315.1 SH3_PRMT2 46..98 CDD:212740
AdoMet_MTases 153..253 CDD:100107 50/102 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.