DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Art6

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster


Alignment Length:351 Identity:138/351 - (39%)
Similarity:217/351 - (61%) Gaps:18/351 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SNNVAKKLP-AEGSTGDNPNANADEMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHL 89
            |.|..:||| .||...|              ||.||:....|..||:|.||...:|:|:..:..|
  Fly     2 SFNANQKLPFLEGKDSD--------------YFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGL 52

  Fly    90 FQGKTVLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEIEL 154
            ||.|.||||||||||||:|||:|||::||||:|::|.:.|.:::.||..::|:.||||.:|::||
  Fly    53 FQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVEL 117

  Fly   155 PNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKIN 219
            |:|||.||||:|||||..|:.|:|:::||:||||||.:.|.:.|..|.|::....| .::...:|
  Fly   118 PDGIEKVDIIVSEWMGNALYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYD-PHRRTNLN 181

  Fly   220 WWDDVYGFDMSCIRKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRND 284
            :|.:|.|.||.|:||....||||:.|..:|:::..|.:...:|...:...:.|.|.|.|.:.|..
  Fly   182 FWCNVEGIDMGCVRKPFSQEPLVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTG 246

  Fly   285 FVQALVTYFNIEFT--KCHKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQMKPNER 347
            .:..||.||::.|.  |.:|.:..:|||.|.:|||:|||.:||:.:..:..:.:.|...|.|..:
  Fly   247 IINMLVLYFDVLFPSGKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQ 311

  Fly   348 NNRDLDFVIDINFKGELSQIQESNTY 373
            :.|.::|.:.|:|:||.::::...::
  Fly   312 DGRGMNFDLHISFRGERTRVESFKSF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 59/99 (60%)
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 72/131 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440104
Domainoid 1 1.000 88 1.000 Domainoid score I5039
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432852at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.