DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Art9

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_650321.1 Gene:Art9 / 41698 FlyBaseID:FBgn0038188 Length:313 Species:Drosophila melanogaster


Alignment Length:299 Identity:98/299 - (32%)
Similarity:154/299 - (51%) Gaps:19/299 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQ 131
            :.||.|.:.|..|.......:.||:.|.||||||.:|:||:.:.:|||.:|:|:......||..:
  Fly    13 DSMLNDVISTRAYEWVFKRYERLFKDKIVLDVGCRSGLLSLMSVEAGAVKVMALGNRESAEFVSK 77

  Fly   132 VVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMM 196
            ..|....:|:...:.|.|.||.||.|::.||||:|||:|:.:|.:|:...|::||:|||.|.|.:
  Fly    78 AFIGTEKEDIFEFIDGDIHEIVLPCGLKKVDIIVSEWVGHSVFVDSLFKEVIFAREKWLVKGGFI 142

  Fly   197 FPDRGTLYITAIEDRQYKDEKINW--WDDVYGFDMSCIRKVAVTEP---LVDVVDPKQVVSTSCM 256
            .|:...|::..|.|...|..::|.  ..|..|      |...|.||   :.|.|..:|:::...:
  Fly   143 IPNVAQLFVCGIADHPRKTVEVNILPQSDYPG------RSYMVREPVSLIEDYVAKEQLITEKYL 201

  Fly   257 VKEVDLYTVQKADLNFSSKFSLCIKRNDFVQALVTYFNIEFTKCHK----RLGFSTSPDSTYTHW 317
            :|.:||.|....|.:|...|.|...|:..:.|:|.|.:|..  |..    ||.|||.|....|:.
  Fly   202 LKTIDLCTAHINDESFRVPFKLRGLRDSQLGAVVLYSDIGL--CRPRGKFRLMFSTGPKRPRTYV 264

  Fly   318 KQTVFYLDDHMTAKKNEEITGTFQM--KPNERNNRDLDF 354
            :||:.::|:.:...|.|.:.|...|  ||:|....:..|
  Fly   265 RQTILFMDNPVEVAKCELVIGELGMYYKPDEHREVEYSF 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 42/99 (42%)
Art9NP_650321.1 AdoMet_MTases 41..143 CDD:100107 43/101 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440102
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.