DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Art4

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster


Alignment Length:342 Identity:130/342 - (38%)
Similarity:189/342 - (55%) Gaps:27/342 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 EMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAKAG 113
            |.:|...||..|.:....:.|::|.|||.||:.|:..|...||.|.|||||.|:||||.||.:||
  Fly   137 EESSASQYFQFYGYLSQQQNMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSGILSFFAVQAG 201

  Fly   114 AAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESM 178
            ||:|.|::.||:.::|:|:|..||:|..|:|:.|||||||||   |.||:||||.|||.|:.|.|
  Fly   202 AAKVYAIEASNMAQYAQQLVESNNVQHKISVIPGKIEEIELP---EKVDVIISEPMGYMLYNERM 263

  Fly   179 LDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKIN----WWDDVY-GFDMSCIRKVAVT 238
            |:|.|:|| ||||..|.|:|..|.|:|....|.....|:.|    |:...: |.|::.:.|..:.
  Fly   264 LETYLHAR-KWLKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANFWYQSAFHGVDLTTLHKEGMK 327

  Fly   239 E----PLVDVVDPKQVVSTSCMVKEV----DLYTVQKADLN-FSSKFSLCIKRNDFVQALVTYFN 294
            |    |:||..|.:     .||.|.|    |....::.||: .|......|.:......|..:|:
  Fly   328 EYFRQPIVDTFDIR-----ICMAKSVRHVCDFLNDKEDDLHLISIPLEFHILQTGICHGLAFWFD 387

  Fly   295 IEFTKCHKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQMKPNERNNRDLDFVIDIN 359
            :||:...:.:..||||.:..|||.|....|...:..|:.:.:||...::.|.|.:.|:  .||::
  Fly   388 VEFSGSSQNVWLSTSPTAPLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLH 450

  Fly   360 FKGELSQIQESNTYRMR 376
            .:|.|  |..|||..::
  Fly   451 IEGTL--ISSSNTLDLK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 59/99 (60%)
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 117/301 (39%)
AdoMet_MTases 183..281 CDD:100107 60/101 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440099
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.